CTRB1 Antibody (3C8)

Images

 
Western Blot: CTRB1 Antibody (3C8) [H00001504-M02] - Analysis of CTRB1 expression in transfected 293T cell line by CTRB1 monoclonal antibody (M02), clone 3C8.Lane 1: CTRB1 transfected lysate (Predicted MW: 27.9 ...read more
Immunocytochemistry/ Immunofluorescence: CTRB1 Antibody (3C8) [H00001504-M02] - Analysis of monoclonal antibody to CTRB1 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: CTRB1 Antibody (3C8) [H00001504-M02] - Detection limit for recombinant GST tagged CTRB1 is 3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
3C8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CTRB1 Antibody (3C8) Summary

Immunogen
CTRB1 (NP_001897, 101 a.a. - 200 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LKIAKVFKNPKFSILTVNNDITLLKLATPARFSQTVSAVCLPSADDDFPAGTLCATTGWGKTKYNANKTPDKLQQAALPLLSNAECKKSWGRRITDVMIC
Specificity
CTRB1 - chymotrypsinogen B1 (3C8)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CTRB1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CTRB1 Antibody (3C8)

  • chymotrypsinogen B
  • chymotrypsinogen B1
  • CTRB
  • EC 3.4.21
  • EC 3.4.21.1
  • FLJ42412
  • MGC88037

Background

Alpha-chymotrypsin (EC 3.4.21.1) is one of a family of serine proteases secreted into the gastrointestinal tract as the inactive precursor chymotrypsinogen. The zymogen is activated by proteolytic cleavage by trypsin (PRSS1; MIM 276000).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4409
Species: Mu
Applications: WB
NBP1-35641
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88824
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
46420002
Species: Hu
Applications: WB, ELISA
NBP1-89519
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-48990
Species: Hu
Applications: ICC/IF, IHC
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
MAB3586
Species: Hu
Applications: WB, IP
AF3848
Species: Hu
Applications: WB, IHC, IP
AF1118
Species: Hu
Applications: WB, IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
H00008767-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA
H00010136-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-05950
Species: Hu, Mu
Applications: WB, ICC/IF
H00001990-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-230
Species: Hu
Applications: WB, IP, PLA

Publications for CTRB1 Antibody (H00001504-M02) (0)

There are no publications for CTRB1 Antibody (H00001504-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CTRB1 Antibody (H00001504-M02) (0)

There are no reviews for CTRB1 Antibody (H00001504-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CTRB1 Antibody (H00001504-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CTRB1 Products

Bioinformatics Tool for CTRB1 Antibody (H00001504-M02)

Discover related pathways, diseases and genes to CTRB1 Antibody (H00001504-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CTRB1 Antibody (H00001504-M02)

Discover more about diseases related to CTRB1 Antibody (H00001504-M02).
 

Pathways for CTRB1 Antibody (H00001504-M02)

View related products by pathway.

PTMs for CTRB1 Antibody (H00001504-M02)

Learn more about PTMs related to CTRB1 Antibody (H00001504-M02).

Blogs on CTRB1

There are no specific blogs for CTRB1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CTRB1 Antibody (3C8) and receive a gift card or discount.

Bioinformatics

Gene Symbol CTRB1
Entrez
Uniprot