CTPS2 Antibody

Immunocytochemistry/Immunofluorescence: CTPS2 Antibody [NBP3-17826] - Staining of human cell line SiHa shows localization to cytosol & mitochondria.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

CTPS2 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RVPVLLEEQSIVKYFKERLHLPIGDSASNLLFKWRNMADRYERLQKICSIA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CTPS2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence, PFA/Triton X-100 is recommended for fixation/permeabilization.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CTPS2 Antibody

• CTP synthase 2
• CTP synthase II
• CTP synthetase 2
• CTP synthetase isoform
• CTP synthetase type 2
• cytidine 5'-triphosphate synthetase 2
• DKFZp686C17207
• EC 6.3.4.2
• FLJ43358
• MGC32997
• UTP--ammonia ligase 2
• UTP-ammonia ligase

Background

The protein encoded by the CTPS2 gene catalyzes the formation of CTP from UTP with the concomitant deamination of glutamineto glutamate. This protein is the rate-limiting enzyme in the synthesis of cytosine nucleotides, which play animportant role in various metabolic processes and provide the precursors necessary for the synthesis of RNA and DNA.Cancer cells that exhibit increased cell proliferation also exhibit an increased activity of this encoded protein.Thus, this protein is an attractive target for selective chemotherapy. Three alternatively spliced transcript variantsencoding the same protein have been described for this gene. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CTPS2