RAI2 Antibody

Western Blot: RAI2 Antibody [NBP2-13199] - Analysis in human cell line EFO-21.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

RAI2 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: AKVIVSVEDAVPTIFCGKIKGLSGVSTKNFSFKREDSVLQGYDINSQGEESMGNAEPLRKPIKNRSIKLKKVNSQEIH
• Predicted Species: Mouse (97%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RAI2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: Use in IHC reported in scientific literature (PMID:33782811) For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  RAI2 Protein (NBP2-13199PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RAI2 Antibody

• retinoic acid induced 2
• retinoic acid-induced protein 2

Background

Retinoic acid plays a critical role in development, cellular growth, and differentiation. The specific function of this retinoic acid-induced gene has not yet been determined; however, it has been suggested to play a role in development. Localization of this gene designates it to be a candidate for diseases such as Nance-Horan syndrome, sensorineural deafness, non-specific X-linked mental retardation, oral-facial-digital syndrome, and Fried syndrome. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RAI2 Antibody (NBP2-13199)(1)

Publication using NBP2-13199

• Nishikawa S, Uemoto Y, Kim TS et al. Low RAI2 expression is a marker of poor prognosis in breast cancer Breast cancer research and treatment 2021-05-01 [PMID: 33782811] (IHC, Human)

Bioinformatics

• Gene Symbol: RAI2