RAI2 Antibody

Images

 
Western Blot: RAI2 Antibody [NBP2-13199] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: RAI2 Antibody [NBP2-13199] - Staining of human cell line HEK 293 shows localization to plasma membrane.
Immunohistochemistry-Paraffin: RAI2 Antibody [NBP2-13199] - Staining of human cerebral cortex shows distinct positivity in neuropil.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RAI2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AKVIVSVEDAVPTIFCGKIKGLSGVSTKNFSFKREDSVLQGYDINSQGEE SMGNAEPLRKPIKNRSIKLKKVNSQEIH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RAI2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RAI2 Protein (NBP2-13199PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RAI2 Antibody

  • retinoic acid induced 2
  • retinoic acid-induced protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004810-M05
Species: Hu
Applications: WB, ELISA, ICC/IF
NB120-3535
Species: Hu, Mu, Fi
Applications: WB, ICC/IF, IHC
MAB7442
Species: Hu
Applications: WB, B/N
NBP1-80891
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00006192-P01
Species: Hu
NBP2-01808
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
NBP1-86055
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006322-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF3320
Species: Hu
Applications: WB, IHC
NBP1-46576
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-80959
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89091
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP2-20541
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82761
Species: Hu
Applications: IHC, IHC-P
NBP1-87239
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-33691
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for RAI2 Antibody (NBP2-13199) (0)

There are no publications for RAI2 Antibody (NBP2-13199).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAI2 Antibody (NBP2-13199) (0)

There are no reviews for RAI2 Antibody (NBP2-13199). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RAI2 Antibody (NBP2-13199) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RAI2 Products

Bioinformatics Tool for RAI2 Antibody (NBP2-13199)

Discover related pathways, diseases and genes to RAI2 Antibody (NBP2-13199). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAI2 Antibody (NBP2-13199)

Discover more about diseases related to RAI2 Antibody (NBP2-13199).

Blogs on RAI2

There are no specific blogs for RAI2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAI2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RAI2