Recombinant Human CTNS Protein

Images

 
SDS-Page: Recombinant Human CTNS Protein [H00001497-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human CTNS Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-400 of Human CTNS full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MIRNWLTIFILFPLKLVEKCESSVSLTVPPVVKLENGSSTNVSLTLRPPLNATLVITFEITFRSKNITILELPDEVVVPPGVTNSSFQVTSQNVGQLTVYLHGNHSNQTGPRIRFLVIRSSAISIINQVIGWIYFVAWSISFYPQVIMNWRRKSVIGLSFDFVALNLTGFVAYSVFNIGLLWVPYIKEQFLLKYPNGVNPVNSNDVFFSLHAVVLTLIIIVQCCLYERGGQRVSWPAIGFLVLAWLFAFVTMIVAAVGVITWLQFLFCFSYIKLAVTLVKYFPQAYMNFYYKSTEGWSIGNVLLDFTGGSFSLLQMFLQSYNNDQWTLIFGDPTKFGLGVFSIVFDVVFFIQHFCLYRKRPGLQAARTGSGSRLRQDWAPSLQPKALPQTTSVSASSLKG

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
CTNS
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
71.5 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CTNS Protein

  • CTNS-LSB
  • cystinosin
  • cystinosis, nephropathic
  • PQLC4

Background

CTNS - cystinosis, nephropathic

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91151
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22217
Species: Hu, Mu, Rt(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
NBP1-84570
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1617
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF482
Species: Mu
Applications: WB, IHC
NBP2-33404
Species: Hu
Applications: IHC, IHC-P
NB200-118
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-57016
Species: Hu
Applications: WB
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33581
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF1177
Species: Hu, Mu
Applications: WB, Simple Western, IHC
NBP2-34085
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82441
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24940
Species: Hu, Ye
Applications: WB
NBP2-38016
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01819
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P
NB110-96417
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
H00001497-P01
Species: Hu
Applications: WB, ELISA, PA, PAGE, AP

Publications for CTNS Recombinant Protein (H00001497-P01) (0)

There are no publications for CTNS Recombinant Protein (H00001497-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CTNS Recombinant Protein (H00001497-P01) (0)

There are no reviews for CTNS Recombinant Protein (H00001497-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CTNS Recombinant Protein (H00001497-P01). (Showing 1 - 1 of 1 FAQ).

  1. I am interested in CTNS Recombinant Protein (H00001497-P01). Can you kindly provide me a full protein sequence of this product?
    • This protein is produced by a Taiwanese company called Abnova and we distribute it for them. We do no in-house testing or development of their products. The sequence comes from the accession listed on the datasheet for this product, AAH32850.1.

Additional CTNS Products

Bioinformatics Tool for CTNS Recombinant Protein (H00001497-P01)

Discover related pathways, diseases and genes to CTNS Recombinant Protein (H00001497-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CTNS Recombinant Protein (H00001497-P01)

Discover more about diseases related to CTNS Recombinant Protein (H00001497-P01).
 

Pathways for CTNS Recombinant Protein (H00001497-P01)

View related products by pathway.

PTMs for CTNS Recombinant Protein (H00001497-P01)

Learn more about PTMs related to CTNS Recombinant Protein (H00001497-P01).
 

Research Areas for CTNS Recombinant Protein (H00001497-P01)

Find related products by research area.

Blogs on CTNS

There are no specific blogs for CTNS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CTNS Antibody (5G6)
H00001497-M09

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CTNS Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CTNS