Home » CTL1/SLC44A1 » CTL1 Antibodies » CTL1/SLC44A1 Antibody

CTL1/SLC44A1 Antibody

 (2 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: CTL1/SLC44A1 Antibody [H00023446-A01] - Detection against Immunogen (38.21 KDa).
Western Blot: CTL1/SLC44A1 Antibody [H00023446-A01] - Detection against Immunogen (38.21 KDa).

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, IHC, IHC-P
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

CTL1/SLC44A1 Antibody Summary

Immunogen
SLC44A1 (NP_536856, 74 a.a. - 183 a.a.) partial recombinant protein with GST tag. TKLEAIPNSGMDHTQRKYVFFLDPCNLDLINRKIKSVALCVAACPRQELKTLSDVQKFAEINGSALCSYNLKPSEYTTSPKSSVLCPKLPVPASAPIPFFHRCAPVNISC
Specificity
SLC44A1 - solute carrier family 44, member 1
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
SLC44A1
Purity
Unpurified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA 1:100-1:2000
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
Application Notes
The quality control of this antibody is limited to Western blot on the immunizing protein. It is also used for ELISA. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig 1:500-1:100
Publications
Read Publications using
H00023446-A01 in the following applications:

  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 28119456). Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
50% Glycerol
Preservative
No Preservative
Purity
Unpurified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CTL1/SLC44A1 Antibody

  • CD92 antigen
  • CD92
  • CDW92 antigen
  • CDw92
  • CDW92choline transporter-like protein 1
  • CHTL1
  • CTL1
  • CTL1CD92RP11-287A8.1
  • SLC44A1
  • Solute carrier family 44 member 1
  • solute carrier family 44, member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NOD2 Antibody (2D9)
NB100-524
Western Blot: NOD2 Antibody (2D9) [NB100-524] - HCMV infection induces NOD2 mRNA and protein in HFFs and U373 cells. E. U373 glioma cells were infected with HCMV Towne strain and levels of NOD1, NOD2 and GAPDH mRNAs were measured by qRT-PCR at indicated time points. F. HFFs were infected with HCMV (Towne) at MOI of 1 PFU/cell and levels of NOD2 protein and B-actin were determined 48 and 72 hpi. G. HFFs were infected with HCMV (Towne) strain at MOI of 0.03 or 3 PFU/cell and levels of NOD2 protein and B-actin were determined at 48 hpi. Quantitative data represent mean values (+/-SD) of triplicate determinations from three independent experiments (*p<0.05, **p<0.01, ***p<0.001, one-way ANOVA test). Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0092704.g001) licensed under a CC-BY licence.
Western Blot: NOD2 Antibody (2D9) [NB100-524] - Total protein from human THP1 and US-OS cells and mouse Raw264.7 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-NOD2 in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunohistochemistry-Frozen: NOD2 Antibody (2D9) [NB100-524] - Overlay of NOD2-DyLight 488 (green) with phase contrast of murine colon. Image from verified customer review.
(1 Review)
(22 Publications)
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
HLA DQ Antibody
(SPV-L3)
NBP2-45041
Flow Cytometry: HLA DQ Antibody (SPV-L3) [NBP2-45041] - Flow Cytometric Analysis of Raji cells. HLA DQ Antibody (SPV-L3) followed by goat anti-Mouse IgG-CF488 (Blue); Isotype Control (Red).
(1 Publication)
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
CTLA-4
[Unconjugated]
7268-CT
Recombinant Human CTLA-4 Fc Chimera (Catalog # 7268-CT) inhibits IL-2 secretion by stimulated Jurkat human acute Tcell leukemia cells. The ED50 for this effect is 0.03-0.15 μg/mL whenstimulated with 1 μg/mL Recombinant Human B7‑1/CD80 Fc Chimera (Catalog # 140-B1).
(3 Reviews)
(1 Publication)
Species: Hu
CHT1 Antibody
(62-2E8)
NB110-74570
Western Blot: CHT1 Antibody (62-2E8) [NB110-74570] - Western Blot Image of anti-CHT1 (62-2E8). Total protein from mouse brain was separated on a 12% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with a 1:500 dilution of anti-CHT1 in 1% milk/TBST. Reactivity was detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunohistochemistry: CHT1 Antibody (62-2E8) [NB110-74570] - Staining of neurons in rat basal forebrain
(3 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC, IHC-Fr, IHC-P
SLC44A2 Antibody
(3D11)
H00057153-M01
Immunohistochemistry-Paraffin: SLC44A2 Antibody (3D11) [H00057153-M01] - Analysis of monoclonal antibody to SLC44A2 on formalin-fixed paraffin-embedded human lymphoma. Antibody concentration 3 ug/ml.
ELISA: SLC44A2 Antibody (3D11) [H00057153-M01] - Detection limit for recombinant GST tagged SLC44A2 is approximately 0.3ng/ml as a capture antibody.
(5 Publications)
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NHE1/SLC9A1
Antibody
NBP1-76847
Western Blot: NHE1/SLC9A1 Antibody [NBP1-76847] - Rat kidney tissue lysate with in with Nhe-1 antibody at (A) 1 and (B) 2 ug/ml.
Immunocytochemistry/Immunofluorescence: NHE1/SLC9A1 Antibody [NBP1-76847] - Immunofluorescence of Nhe-1 in Human Brain tissue with Nhe-1 antibody at 20 ug/mL.
Immunohistochemistry-Paraffin: NHE1/SLC9A1 Antibody [NBP1-76847] - Human brain tissue using Nhe-1 antibody at 2.5 ug/ml.
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
SLC22A2/OCT2
Antibody
NBP1-89417
Immunohistochemistry-Paraffin: SLC22A2/OCT2 Antibody [NBP1-89417] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: SLC22A2/OCT2 Antibody [NBP1-89417] - Analysis in human kidney and liver tissues. Corresponding SLC22A2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SLC22A2/OCT2 Antibody [NBP1-89417] - Staining of human endometrium shows no positivity in glandular cells as expected.
(2 Publications)
Species: Hu, Rt
Applications: WB, IHC, IHC-P, Single-Cell Western
SLC22A3 Antibody
NBP1-69368
Western Blot: SLC22A3 Antibody [NBP1-69368] - This Anti-SLC22A3 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 0.5ug/ml.
Immunohistochemistry: SLC22A3 Antibody [NBP1-69368] - Human kidney
Species: Hu
Applications: WB, IHC, IHC-P
SLC22A1 Antibody
(2C5)
NBP1-51684
Western Blot: SLC22A1 Antibody (2C5) [NBP1-51684] - Analysis using SLC22A1 mAb against HEK293 (1) and SLC22A1(AA: 284-347)-hIgGFc transfected HEK293 (2) cell lysate.
Flow Cytometry: SLC22A1 Antibody (2C5) [NBP1-51684] - Analysis of Jurkat cells using SLC22A1 mouse mAb (green) and negative control (purple).
(6 Publications)
Species: Hu, Mu
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC
OCT4 Antibody
NB100-2379
Western Blot: OCT4 Antibody [NB100-2379] - YM155 significantly reduced tumorsphere formation and inhibited EGFR autophosphorylation and G9a expression. YM155 is reported to suppress cancer stemness; therefore, we used this compound to investigate the cellular mechanism of tumorsphere formation. To compare the cytotoxic capacity of YM155 against tumorsphere formation and parental cell lines, YM155 was applied to HCC827 and A549 cells in the stemness cultured or integrated medium. (F) Moreover, YM155 inhibited EGFR autophosphorylation in A549-derived tumorspheres and reduced Oct4 expression. Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0182149) licensed under a CC-BY licence.
Western Blot: OCT4 Antibody [NB100-2379] - WB detection of OCT4 in mouse brain lysate using OCT4 antibody with ECL based detection. The antibody generated a specific band of OCT4 at the expected ~40kDa position.
Flow Cytometry: OCT4 Antibody [NB100-2379] - An intracellular stain was performed on Jurkat with NB100-2379 and a matched isotype control. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Rabbit IgG (H+L) Cross-Adsorbed Secondary Antibody.
(2 Reviews)
(17 Publications)
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, Flow, ICC/IF, IHC
OCT2 Antibody
(Oct2/2137)
NBP2-75734
Western Blot: OCT2 Antibody (Oct2/2137) [NBP2-75734] - Analysis (A) Recombinant Protein (B) Daudi cell lysate Oct-2 Mouse Monoclonal Antibody (OCT2/2137).
Immunohistochemistry-Paraffin: OCT2 Antibody (Oct2/2137) [NBP2-75734] - Formalin-fixed, paraffin-embedded human Tonsil stained with Oct-2 Mouse Monoclonal Antibody (OCT2/2137).
Western Blot: OCT2 Antibody (Oct2/2137) [NBP2-75734] - Analysis Ramos cell lysate using Oct-2 Mouse Monoclonal Antibody (OCT2/2137).
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, PA
Choline
Acetyltransferase/ChA
NBP1-30052
Western Blot: Choline Acetyltransferase/ChAT Antibody [NBP1-30052] - Rat brain lysate showing specific immunolabeling of the ~70k ChAT.
Immunocytochemistry/Immunofluorescence: Choline Acetyltransferase/ChAT Antibody [NBP1-30052] - Representative images of lumbar spinal cord sections at 130 days immunostained with Choline Acetyltransferase/ChAT. Scale bar, 200 um. Image collected and cropped by CiteAb from the following publication (http://embomolmed.embopress.org/lookup/doi/10.15252/emmm.201808888), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: Choline Acetyltransferase/ChAT Antibody [NBP1-30052] - Rat brainstem showing specific labeling using the anti-ChAT antibody. Image courtesy of Dr. Robert Sloviter, University of Arizona.
(15 Publications)
Species: Hu, Mu, Rt, Ch, Gp, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl, IHC-WhMt
SLC9A5 Antibody
NBP1-80996
Immunocytochemistry/Immunofluorescence: SLC9A5 Antibody [NBP1-80996] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry-Paraffin: SLC9A5 Antibody [NBP1-80996] - Staining of human rectum shows moderate cytoplasmic and membranous positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
OCT1 Antibody
NBP2-21584
Western Blot: OCT1 Antibody [NBP2-21584] - Various whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with OCT1 antibody diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: OCT1 Antibody [NBP2-21584] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: OCT1 protein stained by OCT1 antibody diluted at 1:500. Red: phalloidin, a cytoskeleton marker, stained by () diluted at 1:200. Blue: Hoechst 33342 staining. Scale bar = 10 um.
Immunohistochemistry-Paraffin: OCT1 Antibody [NBP2-21584] - Rat brain. OCT1 antibody diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min.
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Fc gamma
RIIB/CD32b Antibody
NBP2-14905
Western Blot: Fc gamma RIIB/CD32b Antibody [NBP2-14905] - Image from verified customer review.
Immunocytochemistry/Immunofluorescence: Fc gamma RIIB/CD32b Antibody [NBP2-14905] - Analysis of methanol-fixed A431, using antibody at 1:500 dilution.
Western Blot: Fc gamma RIIB/CD32b Antibody [NBP2-14905] - Sample (30 ug of whole cell lysate) A: THP-1 10% SDS PAGE; antibody diluted at 1:1000.
(1 Review)
Species: Hu
Applications: WB, Flow, ICC/IF
Fc gamma
RIIA/CD32a [Unconjuga
1330-CD
1 μg/lane of Recombinant Human Fc gamma  RIIA/CD32a (R167) was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a band at 32 kDa.
Recombinant Human Fc gamma RIIA/CD32a (R167) (Catalog # 1330-CD) binds human IgG with an estimated KD <80 nM.
(11 Publications)
Species: Hu
AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Serum-starved MCF‑7 human breast cancer cells were unstimulated (light orange filled histogram) or activated with 100 ng/mL Recombinant human IGF-1 (Catalog # 291-G1, dark orange filled histogram) for 15 minutes, then stained with Rabbit Anti-Human/Mouse/Rat Phospho‑Akt (S473) Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF887) or control antibody (Catalog # AB-105-C, open histogram), followed by Allophycocyanin-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # F0111). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
(23 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
CTL1/SLC44A1
Antibody
H00023446-A01
CTL1/SLC44A1 Antibody
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P

Publications for CTL1/SLC44A1 Antibody (H00023446-A01)(2)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for CTL1/SLC44A1 Antibody (H00023446-A01) (0)

There are no reviews for CTL1/SLC44A1 Antibody (H00023446-A01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CTL1/SLC44A1 Antibody (H00023446-A01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional CTL1/SLC44A1 Products

Bioinformatics Tool for CTL1/SLC44A1 Antibody (H00023446-A01)

Discover related pathways, diseases and genes to CTL1/SLC44A1 Antibody (H00023446-A01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CTL1/SLC44A1 Antibody (H00023446-A01)

Discover more about diseases related to CTL1/SLC44A1 Antibody (H00023446-A01).
 

Pathways for CTL1/SLC44A1 Antibody (H00023446-A01)

View related products by pathway.

PTMs for CTL1/SLC44A1 Antibody (H00023446-A01)

Learn more about PTMs related to CTL1/SLC44A1 Antibody (H00023446-A01).

Blogs on CTL1/SLC44A1

There are no specific blogs for CTL1/SLC44A1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CTL1/SLC44A1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol SLC44A1
Entrez
OMIM
Uniprot