CTCF Recombinant Protein Antigen

Images

 
There are currently no images for CTCF Recombinant Protein Antigen (NBP2-33854PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CTCF Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CTCF.

Source: E. coli

Amino Acid Sequence: QNQTDGGEVVQDVNSSVQMVMMEQLDPTLLQMKTEVMEGTVAPEAEAAVDDTQIITLQVVNMEEQPINIGELQLVQVPVPVTVPVATTSVEELQGAYENEVSKEGLAESEPMICHTLPLPEGFQVVKVGANGEVETLEQGELPPQEDP

Protein/Peptide Type
Recombinant Protein Antigen
Gene
CTCF
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-33854.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CTCF Recombinant Protein Antigen

  • 11 zinc finger transcriptional repressor
  • 11-zinc finger protein
  • 11-Zinc Finger Protein2
  • CCCTC-binding factor (zinc finger protein)
  • CCCTC-binding Factor
  • CTCF
  • CTCFL paralog
  • transcriptional repressor CTCF

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52405
Species: Hu
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IP
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP2-14081
Species: Hu
Applications: IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56519
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, IHC-FrFl
NBP2-20053
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00091833-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-46218
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NBP1-84999
Species: Hu
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-89917
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56326
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-232
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP

Publications for CTCF Recombinant Protein Antigen (NBP2-33854PEP) (0)

There are no publications for CTCF Recombinant Protein Antigen (NBP2-33854PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CTCF Recombinant Protein Antigen (NBP2-33854PEP) (0)

There are no reviews for CTCF Recombinant Protein Antigen (NBP2-33854PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for CTCF Recombinant Protein Antigen (NBP2-33854PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CTCF Products

Bioinformatics Tool for CTCF Recombinant Protein Antigen (NBP2-33854PEP)

Discover related pathways, diseases and genes to CTCF Recombinant Protein Antigen (NBP2-33854PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CTCF Recombinant Protein Antigen (NBP2-33854PEP)

Discover more about diseases related to CTCF Recombinant Protein Antigen (NBP2-33854PEP).
 

Pathways for CTCF Recombinant Protein Antigen (NBP2-33854PEP)

View related products by pathway.

PTMs for CTCF Recombinant Protein Antigen (NBP2-33854PEP)

Learn more about PTMs related to CTCF Recombinant Protein Antigen (NBP2-33854PEP).
 

Research Areas for CTCF Recombinant Protein Antigen (NBP2-33854PEP)

Find related products by research area.

Blogs on CTCF

There are no specific blogs for CTCF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CTCF Antibody
NB100-56494
CTCF Antibody
NB100-56494
p19ARF Antibody
NB200-106
p19ARF Antibody
NB200-106
p19ARF Antibody
NB200-106

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CTCF Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CTCF
Entrez