CSTP1 Antibody

Images

 
Western Blot: CSTP1 Antibody [NBP1-88048] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: CSTP1 Antibody [NBP1-88048] - Staining of human kidney shows strong cytoplasmic positivity in cells of tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CSTP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MSDAEAGGVFHRARGRTLAAFPAEKESEWKGPFYFILGADPQFGLIKAWSTGDCDNGGDEWEQEIRLTEQAVQAINKLNPKPKFFVLCGDLIHAMP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CPPED1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CSTP1 Protein (NBP1-88048PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CSTP1 Antibody

  • calcineurin-like phosphoesterase domain containing 1
  • calcineurin-like phosphoesterase domain-containing protein 1
  • Complete S-transactivated protein 1
  • CSTP1complete S transactivated protein 1
  • EC 3.1
  • FLJ11151

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01747
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-55995
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P
1202-PI
Species: Hu
MAB1296
Species: Hu
Applications: WB, IP
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP1-85431
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP1-86617
Species: Hu
Applications: ICC/IF, IHC, IHC-P, ICC
NBP2-45897
Species: Hu
Applications: WB, IHC
NBL1-16115
Species: Hu
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-80965
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for CSTP1 Antibody (NBP1-88048) (0)

There are no publications for CSTP1 Antibody (NBP1-88048).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CSTP1 Antibody (NBP1-88048) (0)

There are no reviews for CSTP1 Antibody (NBP1-88048). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CSTP1 Antibody (NBP1-88048) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CSTP1 Products

Bioinformatics Tool for CSTP1 Antibody (NBP1-88048)

Discover related pathways, diseases and genes to CSTP1 Antibody (NBP1-88048). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on CSTP1

There are no specific blogs for CSTP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CSTP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CPPED1