CRY1 Antibody

Images

 
Western Blot: CRY1 Antibody [NBP1-69080] - Sample Tissue: Hela Whole cell, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, ...read more
Immunohistochemistry-Paraffin: CRY1 Antibody [NBP1-69080] - Human testis tissue at an antibody concentration of 5ug/ml.
Western Blot: CRY1 Antibody [NBP1-69080] - Sample Tissue:Hela Whole cell. Lane A: Primary Antibody Lane B: Primary Antibody + Blocking.
Simple Western: CRY1 Antibody [NBP1-69080] - Simple Western lane view shows a specific band for CRY1 in 0.5 mg/ml of HeLa lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, Simple Western, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CRY1 Antibody Summary

Immunogen
Synthetic peptides corresponding to CRY1 (cryptochrome 1 (photolyase-like)) The peptide sequence was selected from the N terminal of CRY1 (NP_004066) Peptide sequence KRFQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEKYGVPSLEELGF.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CRY1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Simple Western 1:50
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 5 ug/ml
Application Notes
In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Theoretical MW
64 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
CRY1 Protein (NBP1-69080PEP)

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CRY1 Antibody

  • CRY1
  • cryptochrome 1 (photolyase-like)
  • Cryptochrome I
  • PHLL1
  • PHLL1cryptochrome-1
  • photolyase-like cryptochrome 1

Background

CRY1 is the blue light-dependent regulator of the circadian feedback loop. 'CRY1 inhibits CLOCK|NPAS2-ARNTL E box-mediated transcription.'CRY1 acts, in conjunction with CRY2, in maintaining period length and circadian rhythmicity. 'CRY1 has no photolyase activity. 'CRY1 is capable of translocating circadian clock core proteins such as PER proteins to the nucleus. 'CRY1 may inhibit CLOCK|NPAS2-ARNTL transcriptional activity through stabilizing the unphosphorylated form of ARNTL.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00749
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-2288
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-125
Species: Hu
Applications: WB, ICC/IF
NBP2-24589
Species: Hu, Mu, Rt, Bv, Eq, Pm
Applications: WB, IHC-P
NBP1-86692
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-126
Species: Hu, Mu
Applications: WB, ChIP
H00008863-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-88027
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46005
Species: Hu
Applications: WB, IHC, IF
H00114769-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
H00064326-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
H00004867-D01P
Species: Hu, Mu
Applications: WB
AF4208
Species: Rt
Applications: WB
NB100-40853
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-1800
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC-P, IP

Publications for CRY1 Antibody (NBP1-69080) (0)

There are no publications for CRY1 Antibody (NBP1-69080).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CRY1 Antibody (NBP1-69080) (0)

There are no reviews for CRY1 Antibody (NBP1-69080). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CRY1 Antibody (NBP1-69080). (Showing 1 - 1 of 1 FAQ).

  1. I just received some NBP1-69080 anti-CRY antibodies. There are no instructions for dilution. Do I dilute with 100 ul PBS?
    • Please accept my apologies that you did not receive the appropriate reconstitution instructions with your Cryptochrome I antibody with catalogue number NBP1-69080. Our information for the reconstitution of this product is as follows: Add 50 ul of distilled water. Final anti-CRY1 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Secondary Antibodies

 

Isotype Controls

Additional CRY1 Products

Bioinformatics Tool for CRY1 Antibody (NBP1-69080)

Discover related pathways, diseases and genes to CRY1 Antibody (NBP1-69080). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CRY1 Antibody (NBP1-69080)

Discover more about diseases related to CRY1 Antibody (NBP1-69080).
 

Pathways for CRY1 Antibody (NBP1-69080)

View related products by pathway.

PTMs for CRY1 Antibody (NBP1-69080)

Learn more about PTMs related to CRY1 Antibody (NBP1-69080).
 

Research Areas for CRY1 Antibody (NBP1-69080)

Find related products by research area.

Blogs on CRY1

There are no specific blogs for CRY1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CRY1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CRY1
Entrez
Uniprot