| Reactivity | Hu, AmSpecies Glossary |
| Applications | WB, Simple Western, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Concentration | 0.5 mg/ml |
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | Synthetic peptides corresponding to CRY1 (cryptochrome 1, photolyase-like). The peptide sequence was selected from the N terminal of CRY1 (NP_004066). Peptide sequence KRFQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEKYGVPSLEELGF. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CRY1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | See Simple Western Antibody Database for Simple Western validation: HeLa lysate at 0.5 mg/ml as sample; separated by size; antibody dilution of 1:50; observed molecular weight was 61 kDa;matrix was 12-230 kDa; detected by Chemiluminescence. |
|
| Theoretical MW | 64 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Reviewed Applications |
|
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Deborah Lutterschmidt |
IHC-Fr | Hyla cinerea | 10/23/2023 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
Research Areas for CRY1 Antibody (NBP1-69080)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Deborah Lutterschmidt 10/23/2023 |
||
| Application: | IHC-Fr | |
| Species: | Hyla cinerea |