CRY1 Antibody Summary
Immunogen |
Synthetic peptides corresponding to CRY1 (cryptochrome 1, photolyase-like). The peptide sequence was selected from the N terminal of CRY1 (NP_004066). Peptide sequence KRFQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEKYGVPSLEELGF. The peptide sequence for this immunogen was taken from within the described region. |
Predicted Species |
Mouse (100%), Rat (100%), Canine (100%), Sheep (100%), Equine (100%), Zebrafish (93%), Bovine (100%), Guinea Pig (100%), Rabbit (93%). Backed by our 100% Guarantee. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
CRY1 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot 1:100-1:2000
- Immunohistochemistry 1:10-1:500
- Immunohistochemistry-Paraffin 5 ug/ml
|
Application Notes |
In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
|
Theoretical MW |
64 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Control |
|
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Purity |
Immunogen affinity purified |
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for CRY1 Antibody
Background
CRY1 is the blue light-dependent regulator of the circadian feedback loop. 'CRY1 inhibits CLOCK|NPAS2-ARNTL E box-mediated transcription.'CRY1 acts, in conjunction with CRY2, in maintaining period length and circadian rhythmicity. 'CRY1 has no photolyase activity. 'CRY1 is capable of translocating circadian clock core proteins such as PER proteins to the nucleus. 'CRY1 may inhibit CLOCK|NPAS2-ARNTL transcriptional activity through stabilizing the unphosphorylated form of ARNTL.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC, KO
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, IB, IHC, IHC-P, KO
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ChIP
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Eq
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Rt
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, ChIP, CHIP-SEQ
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb, Sh, Ze
Applications: WB, IHC, IHC-P
Publications for CRY1 Antibody (NBP1-69080) (0)
There are no publications for CRY1 Antibody (NBP1-69080).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CRY1 Antibody (NBP1-69080) (0)
There are no reviews for CRY1 Antibody (NBP1-69080).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CRY1 Antibody (NBP1-69080). (Showing 1 - 1 of 1 FAQ).
-
I just received some NBP1-69080 anti-CRY antibodies. There are no instructions for dilution. Do I dilute with 100 ul PBS?
- Please accept my apologies that you did not receive the appropriate reconstitution instructions with your Cryptochrome I antibody with catalogue number NBP1-69080. Our information for the reconstitution of this product is as follows: Add 50 ul of distilled water. Final anti-CRY1 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Control Lysate(s)
Secondary Antibodies
| |
Isotype Controls
|
Other Available Formats
Additional CRY1 Products
Bioinformatics Tool for CRY1 Antibody (NBP1-69080)
Discover related pathways, diseases and genes to CRY1 Antibody (NBP1-69080). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for CRY1 Antibody (NBP1-69080)
Discover more about diseases related to CRY1 Antibody (NBP1-69080).
| | Pathways for CRY1 Antibody (NBP1-69080)
View related products by pathway.
|
PTMs for CRY1 Antibody (NBP1-69080)
Learn more about PTMs related to CRY1 Antibody (NBP1-69080).
| | Research Areas for CRY1 Antibody (NBP1-69080)
Find related products by research area.
|
Blogs on CRY1