CRY1 Antibody

Western Blot: CRY1 Antibody [NBP1-69080] - Sample Tissue: Hela Whole cell, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, Lysate Quantity: 25ug/lane, Gel Concentration: 0.12%

Immunohistochemistry-Paraffin: CRY1 Antibody [NBP1-69080] - Human testis tissue at an antibody concentration of 5ug/ml.

Western Blot: CRY1 Antibody [NBP1-69080] - Sample Tissue:Hela Whole cell. Lane A: Primary Antibody Lane B: Primary Antibody + Blocking.

Simple Western: CRY1 Antibody [NBP1-69080] - Simple Western lane view shows a specific band for CRY1 in 0.5 mg/ml of HeLa lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

• Reactivity: Hu
• Applications: WB, Simple Western, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

CRY1 Antibody Summary

• Immunogen: Synthetic peptides corresponding to CRY1 (cryptochrome 1 (photolyase-like)) The peptide sequence was selected from the N terminal of CRY1 (NP_004066) Peptide sequence KRFQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEKYGVPSLEELGF.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CRY1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:100-1:2000
  • Simple Western 1:50
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 5 ug/ml
• Application Notes: In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
• Theoretical MW: 64 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  CRY1 Protein (NBP1-69080PEP)

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CRY1 Antibody

• CRY1
• cryptochrome 1 (photolyase-like)
• Cryptochrome I
• PHLL1
• PHLL1cryptochrome-1
• photolyase-like cryptochrome 1

Background

CRY1 is the blue light-dependent regulator of the circadian feedback loop. 'CRY1 inhibits CLOCK|NPAS2-ARNTL E box-mediated transcription.'CRY1 acts, in conjunction with CRY2, in maintaining period length and circadian rhythmicity. 'CRY1 has no photolyase activity. 'CRY1 is capable of translocating circadian clock core proteins such as PER proteins to the nucleus. 'CRY1 may inhibit CLOCK|NPAS2-ARNTL transcriptional activity through stabilizing the unphosphorylated form of ARNTL.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for CRY1 Antibody (NBP1-69080). (Showing 1 - 1 of 1 FAQ).

1. I just received some NBP1-69080 anti-CRY antibodies. There are no instructions for dilution. Do I dilute with 100 ul PBS?
   • Please accept my apologies that you did not receive the appropriate reconstitution instructions with your Cryptochrome I antibody with catalogue number NBP1-69080. Our information for the reconstitution of this product is as follows: Add 50 ul of distilled water. Final anti-CRY1 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Bioinformatics

• Gene Symbol: CRY1
• Entrez:
  • 1407(Human)
  • 12952(Mouse)
  • 299691(Rat)
• Uniprot:
  • Q16526()