| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VLTLDILDVVTTDPPPDVHVSRVGGLEDQLSVRWVSPPALKDFLFQAKYQIRYRVEDSVDWKVVDDVSNQTSCRLAGLKPGTVY |
| Predicted Species | Mouse (99%), Rat (99%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CRLF1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publications using NBP1-85606 | Applications | Species |
|---|---|---|
| Nalbach K, Schifferer M, Bhattacharya D et al. Spatial proteomics reveals secretory pathway disturbances caused by neuropathy-associated TECPR2 Nature communications 2023-02-16 [PMID: 36797266] (WB, Human) | WB | Human |
| Nalbach K, Schifferer M, Lichtenthaler S et al. Spatial Proteomics Reveals Disturbances in Trafficking and Interactions Along the Secretory Pathway Upon Loss of Neuropathy-Associated TECPR4 SSRN Electronic Journal 2022-03-16 (WB, Human) | WB | Human |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CRLF1 |