CRLF1 Antibody

Western Blot: CRLF1 Antibody [NBP1-85606] - Analysis in human cell line HepG2.

Immunohistochemistry-Paraffin: CRLF1 Antibody [NBP1-85606] - Staining of human skin shows weak cytoplasmic positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: CRLF1 Antibody [NBP1-85606] - Staining of human heart muscle shows moderate cytoplasmic positivity in cardiomyocytes.

Immunohistochemistry-Paraffin: CRLF1 Antibody [NBP1-85606] - Staining of human placenta shows moderate cytoplasmic positivity in Hofbauer cells.

Immunohistochemistry-Paraffin: CRLF1 Antibody [NBP1-85606] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

Product Discontinued

CRLF1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VLTLDILDVVTTDPPPDVHVSRVGGLEDQLSVRWVSPPALKDFLFQAKYQIRYRVEDSVDWKVVDDVSNQTSCRLAGLKPGTVY
• Predicted Species: Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CRLF1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CRLF1 Antibody

• CISS1
• CISScytokine type 1 receptor CRLP-1
• CLF
• CLF1
• CLF-1
• CLF-1class I cytokine receptor
• CRLF1
• CRLF-1
• cytokine receptor-like factor 1
• Cytokine-like factor 1
• NR6
• zcytor5

Background

The CRLF1 gene encodes a member of the cytokine type I receptor family. The protein forms a secreted complex with cardiotrophin-like cytokine factor 1 and acts on cells expressing ciliary neurotrophic factor receptors. The complex can promote survival of neuro

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CRLF1 Antibody (NBP1-85606)(2)

Publications using NBP1-85606

• Nalbach K, Schifferer M, Bhattacharya D et al. Spatial proteomics reveals secretory pathway disturbances caused by neuropathy-associated TECPR2 Nature communications 2023-02-16 [PMID: 36797266] (WB, Human)
• Nalbach K, Schifferer M, Lichtenthaler S et al. Spatial Proteomics Reveals Disturbances in Trafficking and Interactions Along the Secretory Pathway Upon Loss of Neuropathy-Associated TECPR4 SSRN Electronic Journal 2022-03-16 (WB, Human)

FAQs for CRLF1 Antibody (NBP1-85606). (Showing 1 - 1 of 1 FAQs).

1. Does this cross react with other species, specifically rat?
   • NBP1-85606 hasn't been tested in rat but the immunogen shares 99% similarity with rat, so it is predicted to cross-react. If you would be interested in testing this novel species, please take a look at our Innovator's Reward program.

Bioinformatics

• Gene Symbol: CRLF1