CrkL Antibody (4B5)

Images

 
Western Blot: CrkL Antibody (4B5) [H00001399-M03] - Analysis of CRKL expression in transfected 293T cell line by CRKL monoclonal antibody (M03), clone 4B5. Lane 1: CRKL transfected lysatE (33.8 KDa). Lane 2: ...read more
Immunocytochemistry/ Immunofluorescence: CrkL Antibody (4B5) [H00001399-M03] - Analysis of protein-protein interactions between PTK2 and CRKL. Huh7 cells were stained with anti-PTK2 rabbit purified polyclonal 1:600 and ...read more
Western Blot: CrkL Antibody (4B5) [H00001399-M03] - Western blot analysis of CRKL over-expressed 293 cell line, cotransfected with CRKL Validated Chimera RNAi or non-transfected control. Blot probed with H00001399-M03. ...read more
Immunocytochemistry/ Immunofluorescence: CrkL Antibody (4B5) [H00001399-M03] - Analysis of monoclonal antibody to CRKL on HeLa cell. Antibody concentration 10 ug/ml
Immunocytochemistry/ Immunofluorescence: CrkL Antibody (4B5) [H00001399-M03] - Analysis of protein-protein interactions between GAB1 and CRKL. HeLa cells were stained with anti-GAB1 rabbit purified polyclonal 1:1200 and ...read more
ELISA: CrkL Antibody (4B5) [H00001399-M03] - Detection limit for recombinant GST tagged CRKL is approximately 0.3ng/ml as a capture antibody.
Proximity Ligation Assay: CrkL Antibody (4B5) [H00001399-M03] - Analysis of protein-protein interactions between HCK and CRKL. Mahlavu cells were stained with anti-HCK rabbit purified polyclonal 1:1200 and anti-CRKL ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, PLA, RNAi
Clone
4B5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CrkL Antibody (4B5) Summary

Immunogen
CRKL (NP_005198 204 a.a. - 303 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AHAYAQPQTTTPLPAVSGSPGAAITPLPSTQNGPVFAKAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDPQNPDENE
Specificity
CRKL (4B5)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CRKL
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Proximity Ligation Assay
  • RNA Inhibition
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. It has been used for RNAi Validation.
Publications
Read Publications using H00001399-M03.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CrkL Antibody (4B5)

  • CrkL
  • crk-like protein
  • v-crk avian sarcoma virus CT10 oncogene homolog-like
  • v-crk sarcoma virus CT10 oncogene homolog (avian)-like

Background

v-CRK avian sarcoma virus CT10-homolog-like contains one SH2 domain and two SH3 domains. CRKL has been shown to activate the RAS and JUN kinase signaling pathways and transform fibroblasts in a RAS-dependent fashion. It is a substrate of the BCR-ABL tyrosine kinase and plays a role in fibroblast transformation by BCR-ABL. In addition, CRKL has oncogenic potential.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5414
Species: Hu
Applications: WB, Simple Western
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-49154
Species: Hu
Applications: IHC
NBP2-37574
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC
MAB38461
Species: Hu
Applications: WB, IHC
NBP2-45515
Species: Hu, Rt, Ca, Mk
Applications: WB, IHC, IF
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
AF1584
Species: Hu, Mu
Applications: WB, Simple Western, IP, CyTOF-ready, ICC, ICFlow
H00006464-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, PLA
NBP2-00532
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-46076
Species: Hu
Applications: WB, IHC
NBP2-00622
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
NB100-292
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-85383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00001399-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, PLA, RNAi

Publications for CrkL Antibody (H00001399-M03)(2)

Reviews for CrkL Antibody (H00001399-M03) (0)

There are no reviews for CrkL Antibody (H00001399-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CrkL Antibody (H00001399-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CrkL Products

Bioinformatics Tool for CrkL Antibody (H00001399-M03)

Discover related pathways, diseases and genes to CrkL Antibody (H00001399-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CrkL Antibody (H00001399-M03)

Discover more about diseases related to CrkL Antibody (H00001399-M03).
 

Pathways for CrkL Antibody (H00001399-M03)

View related products by pathway.

PTMs for CrkL Antibody (H00001399-M03)

Learn more about PTMs related to CrkL Antibody (H00001399-M03).
 

Research Areas for CrkL Antibody (H00001399-M03)

Find related products by research area.

Blogs on CrkL

There are no specific blogs for CrkL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CrkL Antibody (4B5) and receive a gift card or discount.

Bioinformatics

Gene Symbol CRKL
Entrez
OMIM
Uniprot