CRHR2/CRF2 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the amino acids: PCPEYFNGVKYNTTRNAYRECLENGTWASKINYSQCEPILDDKQRKYDLHYR |
| Predicted Species |
Mouse (92%), Rat (92%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CRHR2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for CRHR2/CRF2 Antibody - BSA Free
Background
Official Gene Symbol: CRHR2 Gen Bank Accession Number: NP_001874 Gene ID: 1395 (Human) Gene Map Locus: 7p15.1 (Human) CRHR2 is a novel member of Secretin-family-GPCR proteins that functions as a functional receptor for CRF. It is expressed as 3 isoforms; alpha, beta and gamma. These isoforms primarily differ in their N-terminal sequence and tissue distribution. Apart from CRF, other ligands of CRHR2 include UcnI, UcnII and UcnIII. CRHR2 is involved in stress responses, cardiovascular function and gastric motility. Studies on CRHR2 deficient mice suggested a central anxiolytic effect of CRHR2. Northern Blot analysis detects CRHR2 expression in brain, hypothalamus, heart, GI, lung, skeletal muscle and vasculature.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, PEP-ELISA, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, WB
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: PEP-ELISA, WB
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: EnzAct
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Publications for CRHR2/CRF2 Antibody (NBP2-13875) (0)
There are no publications for CRHR2/CRF2 Antibody (NBP2-13875).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CRHR2/CRF2 Antibody (NBP2-13875) (0)
There are no reviews for CRHR2/CRF2 Antibody (NBP2-13875).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for CRHR2/CRF2 Antibody (NBP2-13875) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CRHR2/CRF2 Products
Research Areas for CRHR2/CRF2 Antibody (NBP2-13875)
Find related products by research area.
|
Blogs on CRHR2/CRF2