CREB3L2 Antibody (1B8) - Azide and BSA Free Summary
| Description |
Novus Biologicals Mouse CREB3L2 Antibody (1B8) - Azide and BSA Free (H00064764-M03) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
CREB3L2 (NP_919047.2, 421 a.a. ~ 518 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ASVVRSRNLLIYEEHSPPEESSSPGSAGELGGWDRGSSLLRVSGLESRPDVDLPHFIISNETSLEKSVLLELQQHLVSAKLEGNETLKVVELDRRVNT |
| Specificity |
CREB3L2 - cAMP responsive element binding protein 3-like 2 (1B8) |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
CREB3L2 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Sandwich ELISA
- Western Blot 1:500
|
| Application Notes |
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for CREB3L2 Antibody (1B8) - Azide and BSA Free
Background
CREB3L2 is a member of the old astrocyte specifically induced substance (OASIS) DNA binding and basic leucine zipper dimerization (bZIP) family of transcription factors, which includes CREB3 (MIM 606443) and CREB4 (MIM 607138).[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
Species: Hu
Applications: ChIP-EXO-SEQ, IHC, IHC-P
Species: Hu, Mu, Pl, Po, Rb, Rt
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, Simple Western, WB
Species: Hu
Applications: ELISA, ICC/IF, KD, PLA, WB
Species: Mu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, KD, S-ELISA, WB
Species: Ha, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IP, WB
Species: Dr, Gt, SyHa, Hu, Ma, Pm, Mu, Po, Pm, Rb, Rt
Applications: ChIP, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: KO, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: Bind, BA
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, Neut, WB
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: EnzAct
Publications for CREB3L2 Antibody (H00064764-M03) (0)
There are no publications for CREB3L2 Antibody (H00064764-M03).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CREB3L2 Antibody (H00064764-M03) (0)
There are no reviews for CREB3L2 Antibody (H00064764-M03).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CREB3L2 Antibody (H00064764-M03) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CREB3L2 Products
Research Areas for CREB3L2 Antibody (H00064764-M03)
Find related products by research area.
|
Blogs on CREB3L2