Orthogonal Strategies: Immunohistochemistry-Paraffin: CRB3 Antibody [NBP1-81185] - Analysis in human kidney and cerebral cortex tissues using NBP1-81185 antibody. Corresponding CRB3 RNA-seq data are presented for ...read more
Immunocytochemistry/ Immunofluorescence: CRB3 Antibody [NBP1-81185] - Staining of human cell line U-2 OS shows localization to cell junctions. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CRB3 Antibody [NBP1-81185] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: CRB3 Antibody [NBP1-81185] - Staining of human duodenum shows high expression.
Use in WB, IP reported in scientific literature (PMID:34404733). ICC/IF reported in scientific literature (PMID: 26493500). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Human reactivity reported in scientific literature (PMID: 26493500). Mouse reactivity reported in scientific literature (PMID: 29155075).
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified
Alternate Names for CRB3 Antibody
crumbs 3
crumbs homolog 3 (Drosophila)
crumbs protein homolog 3
MGC17303
Background
The CRB3 gene encodes a member of the Crumbs family of proteins. This protein may play a role in epithelial cell polarity and is associated with tight junctions at the apical surface of epithelial cells. Alternate transcriptional splice variants, encoding dif
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
FAQs for CRB3 Antibody (NBP1-81185). (Showing 1 - 2 of 2 FAQs).
Can you please tell me if this antibody works for mouse?
In regards to your inquiry, we have not yet tested this antibody on mouse samples. I ran an alignment against the antigen sequence (VRKLREKRQTEGTYRPSSEEQFSHAAEARAPQDSKETVQGCLPI) with the mouse information on UniProt and found that it has very high similarity with Isoform 2. There is a chance this will work in mouse samples. If you would like to try this antibody in mouse samples, you can qualify for our Innovators Reward Program.
I am planning to use CRB3 antibody (NBP1-81185) for my bovine samples for IF. Has the antibody ever been tested with bovine samples and what is the sequence indenty of the epitope sequence with respect to bovine species?
Our product NBP1-81185 has not yet been tested for detection of the bovine protein. I was also not able to find the bovine CRB3 protein to run an alignment against, so I do not have any homology data available.
Bioinformatics Tool for CRB3 Antibody (NBP1-81185)
Discover related pathways, diseases and genes to CRB3 Antibody (NBP1-81185). Need help?
Read the Bioinformatics Tool Guide for instructions on using this tool.
Diseases for CRB3 Antibody (NBP1-81185)
Discover more about diseases related to CRB3 Antibody (NBP1-81185).
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our CRB3 Antibody and receive a gift card or discount.