CRB3 Antibody

Immunohistochemistry-Paraffin: CRB3 Antibody [NBP1-81185] - Analysis in human kidney and cerebral cortex tissues using NBP1-81185 antibody. Corresponding CRB3 RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: CRB3 Antibody [NBP1-81185] - Staining of human cell line U-2 OS shows localization to cell junctions. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: CRB3 Antibody [NBP1-81185] - Staining of human cerebral cortex shows low expression as expected.

Immunohistochemistry-Paraffin: CRB3 Antibody [NBP1-81185] - Staining of human duodenum shows high expression.

Product Discontinued

CRB3 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VRKLREKRQTEGTYRPSSEEQFSHAAEARAPQDSKETVQGCLPI
• Predicted Species: Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CRB3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Immunoprecipitation Reported in scientific literature (PMID:34404733)
  • Western Blot Reported in scientific literature (PMID:34404733)
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 29155075).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CRB3 Antibody

• crumbs 3
• crumbs homolog 3 (Drosophila)
• crumbs protein homolog 3
• MGC17303

Background

The CRB3 gene encodes a member of the Crumbs family of proteins. This protein may play a role in epithelial cell polarity and is associated with tight junctions at the apical surface of epithelial cells. Alternate transcriptional splice variants, encoding dif

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CRB3 Antibody (NBP1-81185)(6)

Publications using NBP1-81185

• Hwang D, Kim M, Kim S Et al. AMOTL2 mono-ubiquitination by WWP1 promotes contact inhibition by facilitating LATS activation Life science alliance 2021-10-01 [PMID: 34404733] (IP, WB)
• Engevik AC, Krystofiak ES, Kaji I et al. Recruitment of Polarity Complexes and Tight Junction Proteins to the Site of Apical Bulk Endocytosis Cellular and molecular gastroenterology and hepatology 2021-02-03 [PMID: 33548596] (IHC-P, Mouse)
• Youk, J, Kim, T Et al. Three-Dimensional Human Alveolar Stem Cell Culture Models Reveal Infection Response to SARS-CoV-2. Cell Stem Cell 2020-12-03 [PMID: 33142113] (ICC/IF)
• Nyeng P, Heilmann S, Lof-Ohlin ZM et al. p120ctn-Mediated Organ Patterning Precedes and Determines Pancreatic Progenitor Fate Dev. Cell 2019-03-05 [PMID: 30853440] (IF/IHC, Mouse)
• Jiang X, An W, Yang X et al. Asymmetric distribution of CRUMBS polarity complex proteins from compacted 8-cell to blastocyst stage during mouse preimplantation development. Gene Expr Patterns 2018-01-01 [PMID: 29155075] (Mouse)
• Freedman BS, Brooks CR, Lam AQ et al. Modelling kidney disease with CRISPR-mutant kidney organoids derived from human pluripotent epiblast spheroids. Nat Commun 2015-01-01 [PMID: 26493500] (ICC/IF, Human)

FAQs for CRB3 Antibody (NBP1-81185). (Showing 1 - 2 of 2 FAQs).

1. Can you please tell me if this antibody works for mouse?
   • In regards to your inquiry, we have not yet tested this antibody on mouse samples. I ran an alignment against the antigen sequence (VRKLREKRQTEGTYRPSSEEQFSHAAEARAPQDSKETVQGCLPI) with the mouse information on UniProt and found that it has very high similarity with Isoform 2. There is a chance this will work in mouse samples. If you would like to try this antibody in mouse samples, you can qualify for our Innovators Reward Program.
2. I am planning to use CRB3 antibody (NBP1-81185) for my bovine samples for IF. Has the antibody ever been tested with bovine samples and what is the sequence indenty of the epitope sequence with respect to bovine species?
   • Our product NBP1-81185 has not yet been tested for detection of the bovine protein. I was also not able to find the bovine CRB3 protein to run an alignment against, so I do not have any homology data available.

Bioinformatics

• Gene Symbol: CRB3
• Entrez:
  • 92359(Human)
• Uniprot:
  • Q9BUF7(Human)