Home » CRB3 » CRB3 Antibodies » CRB3 Antibody

CRB3 Antibody

 (3 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: CRB3 Antibody [NBP1-81185] - Staining of human cell line U-2 OS shows localization to cell junctions. Antibody staining is shown in green.
Immunocytochemistry/ Immunofluorescence: CRB3 Antibody [NBP1-81185] - Staining of human cell line U-2 OS shows localization to cell junctions. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CRB3 Antibody [NBP1-81185] - Analysis in human kidney and cerebral cortex tissues using NBP1-81185 antibody. Corresponding CRB3 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: CRB3 Antibody [NBP1-81185] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: CRB3 Antibody [NBP1-81185] - Staining of human duodenum shows high expression.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

CRB3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VRKLREKRQTEGTYRPSSEEQFSHAAEARAPQDSKETVQGCLPI
Specificity
Specificity of human CRB3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CRB3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
ICC/IF reported in scientific literature (PMID: 26493500). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CRB3 Protein (NBP1-81185PEP)
Publications
Read Publications using
NBP1-81185 in the following applications:

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 26493500). Mouse reactivity reported in the scientific literature (PMID: 29155075).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CRB3 Antibody

  • crumbs 3
  • crumbs homolog 3 (Drosophila)
  • crumbs protein homolog 3
  • MGC17303

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PALS1/MPP5 Antibody
NB300-952
Immunocytochemistry/Immunofluorescence: PALS1/MPP5 Antibody [NB300-952] - Immunofluorescence analysis of paraformaldehyde fixed HeLa cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing Golgi and cytoplasmic staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL).
Immunohistochemistry-Paraffin: PALS1/MPP5 Antibody [NB300-952] - Staining of paraffin embedded Human Kidney. Antibody at 5 ug/mL. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Flow Cytometry: PALS1/MPP5 Antibody [NB300-952] - Flow cytometric analysis of paraformaldehyde fixed HeLa cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
(1 Publication)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
PATJ Antibody
NB100-1354
Flow Cytometry: PATJ Antibody [NB100-1354] - Analysis of paraformaldehyde fixed A431 cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
Immunofluorescence: PATJ Antibody [NB100-1354] - Analysis of paraformaldehyde fixed A431 cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing junctional staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL).
(1 Publication)
Species: Hu
Applications: Flow, PEP-ELISA, IF
CRB1 Antibody
NBP2-56113
Western Blot: CRB1 Antibody [NBP2-56113] - Analysis in human cell line RT-4, human cell line U-251 MG and human plasma.
Immunohistochemistry-Paraffin: CRB1 Antibody [NBP2-56113] - Staining of human retina shows cytoplasmic positivity in all layers of retina.
Species: Hu
Applications: WB, IHC, IHC-P
CRB2 Antibody
NBP1-91809
Immunohistochemistry-Paraffin: CRB2 Antibody [NBP1-91809] - Staining of human retina shows strong positivity in outer limiting membrane.
Species: Hu
Applications: IHC, IHC-P
Tight Junction
Protein 1 Antibody
NBP1-85047
Knockout Validated: Tight Junction Protein 1 Antibody [NBP1-85047] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and TJP1 knockout (KO) HeLa cell line. PVDF membrane was probed with 1:200 of Rabbit Anti-Human TJP1 Polyclonal Antibody (Catalog # NBP1-85047) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for TJP1 at approximately 260 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Immunohistochemistry-Paraffin: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining in human testis and skeletal muscle tissues. Corresponding TJP1 RNA-seq data are presented for the same tissues.
Western Blot: Tight Junction Protein 1 Antibody [NBP1-85047] - Analysis in human cell line A-431.
(5 Reviews)
(7 Publications)
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KO
MUPP1 Antibody
NBP1-87839
Immunohistochemistry-Paraffin: MUPP1 Antibody [NBP1-87839] - Staining of human stomach shows strong membranous positivity in glandular cells.
(1 Review)
Species: Hu
Applications: IHC, IHC-P
PARD6A Antibody
NBP2-38487
Western Blot: PARD6A Antibody [NBP2-38487] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG
Immunocytochemistry/Immunofluorescence: PARD6A Antibody [NBP2-38487] - Staining of human cell line MCF7 shows localization to actin filaments & cell junctions. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PARD6A Antibody [NBP2-38487] - Staining of human testis shows moderate membranous positivity in cells in seminiferous ducts.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
SLC22A3 Antibody
NBP1-69368
Western Blot: SLC22A3 Antibody [NBP1-69368] - This Anti-SLC22A3 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 0.5ug/ml.
Immunohistochemistry: SLC22A3 Antibody [NBP1-69368] - Human kidney
Species: Hu
Applications: WB, IHC, IHC-P
ITK Antibody (5G6)
NBP2-37578
Western Blot: ITK Antibody (5G6) [NBP2-37578] - Analysis using ITK mouse mAb against Jurkat cell lysate.
Immunocytochemistry/Immunofluorescence: ITK Antibody (5G6) [NBP2-37578] - Immunofluorescence analysis of Jurkat cells using ITK mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye.
Flow Cytometry: ITK Antibody (5G6) [NBP2-37578] - Analysis of Jurkat cells using ITK mouse mAb (blue) and negative control (red).
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
ZEB1 Antibody
NBP1-05987
Immunohistochemistry: ZEB1 Antibody [NBP1-05987] - Immunohistochemical staining results of EMT regulators in HG-PanIN: SNAIL, SLUG, TWIST1, and ZEB1. We categorized and defined three grades: grade 0, <10% positive staining; grade 1, 10%-50% positive; grade 2, 50%< positive Image collected and cropped by CiteAb from the following publication (https://onlinelibrary.wiley.com/doi/abs/10.1002/cam4.2016) licensed under a CC-BY licence.
Western Blot: ZEB1 Antibody [NBP1-05987] - Samples: Whole cell lysate (15 ug) from HeLa, HEK293T, Jurkat, mouse TCMK-1, and mouse NIH 3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-ZEB1 antibody (NBP1-05987) used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Immunohistochemistry-Paraffin: ZEB1 Antibody [NBP1-05987] - Sample: FFPE section of human breast carcinoma. Antibody: Affinity purified rabbit anti-ZEB1 (NBP1-05987) used at a dilution of 1:1000 (0.2 ug/ml). Detection: DAB.
(6 Reviews)
(64 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP, MiAr, ChIP, KD, Single-Cell Western
JTB Antibody
NBP1-81746
Western Blot: JTB Antibody [NBP1-81746] - Analysis in control (vector only transfected HEK293T lysate) and JTB over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: JTB Antibody [NBP1-81746] - Immunofluorescent staining of human cell line U-251 MG shows localization to vesicles.
Immunohistochemistry-Paraffin: JTB Antibody [NBP1-81746] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PXR/NR1I2 Antibody
(H4417) [Unconjugated ...
PP-H4417-00
PXR/NR1I2 Antibody (H4417) [Unconjugated]
(1 Publication)
Species: Hu
Applications: WB, IP, DirELISA
Claudin-7 Antibody
(6-G3)
NBP2-66784
Western Blot: Claudin-7 Antibody (6-G3) [NBP2-66784] - Analysis on SW480 cell lysate using anti- CLDN7 mouse mAb.
Immunocytochemistry/Immunofluorescence: Claudin-7 Antibody (6-G3) [NBP2-66784] - Staining CLDN7 in SW480 cells (red). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Occludin Antibody
NBP1-87402
Western Blot: Occludin Antibody [NBP1-87402] - Analysis in human cell line CACO-2 and human cell line HeLa.
Western Blot: Occludin Antibody [NBP1-87402] - Lane 1: untreated vascular endothelial cells Lane 2: vascular endothelial cells + control siRNA. Primary antibody was diluted 1:1000. Image submitted by a verified customer review.
Immunocytochemistry/Immunofluorescence: Occludin Antibody [NBP1-87402] - Staining of human cell line A-431 shows localization to plasma membrane & cell junctions. Antibody staining shown in green.
(2 Reviews)
(12 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
TSC1 Antibody
(OTI3A2)
NBP2-46234
Western Blot: TSC1 Antibody (3A2) [NBP2-46234] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY TSC1.
Immunohistochemistry: TSC1 Antibody (3A2) [NBP2-46234] - Analysis of Adenocarcinoma of Human colon tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Western Blot: TSC1 Antibody (3A2) [NBP2-46234] - Analysis of extracts (10ug) from 2 different cell lines.
Species: Hu, Mu, Rt
Applications: WB, IHC
TSC2 Antibody
(614204) [Unconjugate
MAB40401
Western blot shows lysates of HEK293 human embryonic kidney cell line, HeLa human cervical epithelial carcinoma cell line, Daudi human Burkitt's lymphoma cell line, and NIH‑3T3 mouse embryonic fibroblast cell line. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human/Mouse TSC2 Monoclonal Antibody (Catalog # MAB40401) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for TSC2 at approximately 200 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
TSC2 was detected in immersion fixed HeLa human cervical epithelial carcinoma cell line using Mouse Anti-Human/Mouse TSC2 Monoclonal Antibody (Catalog # MAB40401) at 3 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to plasma membrane. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
TSC2 was detected in immersion fixed paraffin-embedded sections of human kidney using Mouse Anti-Human/Mouse TSC2 Monoclonal Antibody (Catalog # MAB40401) at 15 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Specific staining was localized to epithelial cell cytoplasm in convoluted tubules. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Species: Hu, Mu
Applications: WB, IHC, ICC
PARD3/Par3 Antibody
NBP1-88861
Western Blot: PARD3/Par3 Antibody [NBP1-88861] - Analysis in human cell lines A-549 and U-251MG. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Immunocytochemistry/Immunofluorescence: PARD3/Par3 Antibody [NBP1-88861] - MCAM is required to establish cell autonomous polarity. In wild-type myotubes PAR3 remains cytoplasmic. MCAM contributes to the establishment of cell autonomous polarity in myogenic and chondrogenic differentiation. Biol Open (2017)
Immunohistochemistry-Paraffin: PARD3/Par3 Antibody [NBP1-88861] - Staining of human skin shows weak to moderate cytoplasmic positivity in epidermal cells.
(2 Reviews)
(4 Publications)
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
LIN7C Antibody
NBP2-14193
Immunohistochemistry-Paraffin: LIN7C Antibody [NBP2-14193] - Staining of human tonsil shows moderate granular cytoplasmic positivity in germinal center cells.
Immunohistochemistry-Paraffin: LIN7C Antibody [NBP2-14193] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: LIN7C Antibody [NBP2-14193] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Species: Hu
Applications: IHC, IHC-P
Lnx1 Antibody
NBP1-80518
Western Blot: Lnx1 Antibody [NBP1-80518] - Host: Rabbit. Target Name: LNX1. Sample Tissue: Human 786-0 Whole Cell. Antibody Dilution: 1ug/ml
Western Blot: Lnx1 Antibody [NBP1-80518] - Transfected 293T cell lysate, concentration 1.25ug/ml.
Species: Hu
Applications: WB
CRB3 Antibody
NBP1-81185
CRB3 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for CRB3 Antibody (NBP1-81185)(3)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 2 applications: ICC/IF, IHC.


Filter By Application
ICC/IF
(1)
IHC
(1)
All Applications
Filter By Species
Human
(1)
Mouse
(2)
All Species

Reviews for CRB3 Antibody (NBP1-81185) (0)

There are no reviews for CRB3 Antibody (NBP1-81185). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CRB3 Antibody (NBP1-81185). (Showing 1 - 2 of 2 FAQs).

  1. Can you please tell me if this antibody works for mouse?
    • In regards to your inquiry, we have not yet tested this antibody on mouse samples. I ran an alignment against the antigen sequence (VRKLREKRQTEGTYRPSSEEQFSHAAEARAPQDSKETVQGCLPI) with the mouse information on UniProt and found that it has very high similarity with Isoform 2. There is a chance this will work in mouse samples. If you would like to try this antibody in mouse samples, you can qualify for our Innovators Reward Program.
  2. I am planning to use CRB3 antibody (NBP1-81185) for my bovine samples for IF. Has the antibody ever been tested with bovine samples and what is the sequence indenty of the epitope sequence with respect to bovine species?
    • Our product NBP1-81185 has not yet been tested for detection of the bovine protein. I was also not able to find the bovine CRB3 protein to run an alignment against, so I do not have any homology data available.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional CRB3 Products

Bioinformatics Tool for CRB3 Antibody (NBP1-81185)

Discover related pathways, diseases and genes to CRB3 Antibody (NBP1-81185). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CRB3 Antibody (NBP1-81185)

Discover more about diseases related to CRB3 Antibody (NBP1-81185).
 

Pathways for CRB3 Antibody (NBP1-81185)

View related products by pathway.

PTMs for CRB3 Antibody (NBP1-81185)

Learn more about PTMs related to CRB3 Antibody (NBP1-81185).

Blogs on CRB3

There are no specific blogs for CRB3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CRB3 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol CRB3
Entrez
Uniprot