CRB3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CRB3 Antibody [NBP1-81185] - Staining of human cell line U-2 OS shows localization to cell junctions. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CRB3 Antibody [NBP1-81185] - Analysis in human kidney and cerebral cortex tissues using NBP1-81185 antibody. Corresponding CRB3 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: CRB3 Antibody [NBP1-81185] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: CRB3 Antibody [NBP1-81185] - Staining of human duodenum shows high expression.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CRB3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VRKLREKRQTEGTYRPSSEEQFSHAAEARAPQDSKETVQGCLPI
Specificity
Specificity of human CRB3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CRB3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
ICC/IF reported in scientific literature (PMID: 26493500). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CRB3 Protein (NBP1-81185PEP)
Publications
Read Publications using
NBP1-81185 in the following applications:

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 26493500). Mouse reactivity reported in the scientific literature (PMID: 29155075).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CRB3 Antibody

  • crumbs 3
  • crumbs homolog 3 (Drosophila)
  • crumbs protein homolog 3
  • MGC17303

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-952
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NB100-1354
Species: Hu
Applications: Flow, PEP-ELISA, IF
NBP2-56113
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91809
Species: Hu
Applications: IHC, IHC-P
NBP1-85047
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KO
NBP1-87839
Species: Hu
Applications: IHC, IHC-P
NBP2-38487
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-69368
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37578
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-05987
Species: Hu, Mu, Rt
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP, MiAr, ChIP, KD, Single-Cell Western
NBP1-81746
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NBP2-66784
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-87402
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-46234
Species: Hu, Mu, Rt
Applications: WB, IHC
MAB40401
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-88861
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-14193
Species: Hu
Applications: IHC, IHC-P
NBP1-80518
Species: Hu
Applications: WB
NBP1-81185
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for CRB3 Antibody (NBP1-81185)(3)

Reviews for CRB3 Antibody (NBP1-81185) (0)

There are no reviews for CRB3 Antibody (NBP1-81185). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CRB3 Antibody (NBP1-81185). (Showing 1 - 2 of 2 FAQs).

  1. Can you please tell me if this antibody works for mouse?
    • In regards to your inquiry, we have not yet tested this antibody on mouse samples. I ran an alignment against the antigen sequence (VRKLREKRQTEGTYRPSSEEQFSHAAEARAPQDSKETVQGCLPI) with the mouse information on UniProt and found that it has very high similarity with Isoform 2. There is a chance this will work in mouse samples. If you would like to try this antibody in mouse samples, you can qualify for our Innovators Reward Program.
  2. I am planning to use CRB3 antibody (NBP1-81185) for my bovine samples for IF. Has the antibody ever been tested with bovine samples and what is the sequence indenty of the epitope sequence with respect to bovine species?
    • Our product NBP1-81185 has not yet been tested for detection of the bovine protein. I was also not able to find the bovine CRB3 protein to run an alignment against, so I do not have any homology data available.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CRB3 Products

Bioinformatics Tool for CRB3 Antibody (NBP1-81185)

Discover related pathways, diseases and genes to CRB3 Antibody (NBP1-81185). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CRB3 Antibody (NBP1-81185)

Discover more about diseases related to CRB3 Antibody (NBP1-81185).
 

Pathways for CRB3 Antibody (NBP1-81185)

View related products by pathway.

PTMs for CRB3 Antibody (NBP1-81185)

Learn more about PTMs related to CRB3 Antibody (NBP1-81185).

Blogs on CRB3

There are no specific blogs for CRB3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CRB3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CRB3
Entrez
Uniprot