Craniofacial Development Protein 1 Antibody (5B7) - Azide and BSA Free

Western Blot: Craniofacial Development Protein 1 Antibody (5B7) [H00010428-M04] - Detection against Immunogen (34.98 KDa) .

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 5B7
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Craniofacial Development Protein 1 Antibody (5B7) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse Craniofacial Development Protein 1 Antibody (5B7) - Azide and BSA Free (H00010428-M04) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: CFDP1 (NP_006315, 168 a.a. ~ 251 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VFDFAGEEVRVTKEVDATSKEAKSFFKQNEKEKPQANVPSALPSLPAGSGLKRSSGMSSLLGKIGAKKQKMSTLEKSKLDWESF
• Specificity: CFDP1 (5B7)
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: CFDP1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Craniofacial Development Protein 1 Antibody (5B7) - Azide and BSA Free

• BCNTBUCENTAUR
• Bucentaur
• CP27phosphoprotein (Bucentaur)
• craniofacial development protein 1
• p97
• SWC5
• Yeti

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CFDP1
• Entrez:
  • 10428(Human)
• OMIM:
  • 608108(Human)
• Uniprot:
  • NP_006315(Human)