CRABP1 Antibody

Images

 
Immunohistochemistry-Paraffin: CRABP1 Antibody [NBP1-84384] - Staining of human vagina shows cytoplasmic and nuclear positivity in squamous epithelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CRABP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QFYIKTSTTVRTTEINFKVGEGFEEETVDGRKCRSLATWENENKIHCTQTLLEGDGPKTYWTRELANDELILTFGADDVVCTRIYVRE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CRABP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CRABP1 Protein (NBP1-84384PEP)
Publications
Read Publication using
NBP1-84384 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24626200).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CRABP1 Antibody

  • cellular retinoic acid binding protein 1
  • CRABP
  • CRABPI
  • CRABP-Icellular retinoic acid-binding protein 1
  • RBP5Cellular retinoic acid-binding protein I

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00637
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-2590
Species: Hu
Applications: IP (-), WB, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-322
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
NBP1-58922
Species: Hu
Applications: WB
NBP1-81776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47871
Species: Hu, Mk, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-16061
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-56552
Species: Hu
Applications: WB
NBP2-59322
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-89942
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
MAB3765
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow
NB100-56637
Species: Hu, Mu
Applications: WB
NBP1-80851
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for CRABP1 Antibody (NBP1-84384)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for CRABP1 Antibody (NBP1-84384) (0)

There are no reviews for CRABP1 Antibody (NBP1-84384). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CRABP1 Antibody (NBP1-84384) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CRABP1 Products

Bioinformatics Tool for CRABP1 Antibody (NBP1-84384)

Discover related pathways, diseases and genes to CRABP1 Antibody (NBP1-84384). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CRABP1 Antibody (NBP1-84384)

Discover more about diseases related to CRABP1 Antibody (NBP1-84384).
 

Pathways for CRABP1 Antibody (NBP1-84384)

View related products by pathway.

PTMs for CRABP1 Antibody (NBP1-84384)

Learn more about PTMs related to CRABP1 Antibody (NBP1-84384).
 

Research Areas for CRABP1 Antibody (NBP1-84384)

Find related products by research area.

Blogs on CRABP1

There are no specific blogs for CRABP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CRABP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CRABP1