Recombinant Human CPT2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CPT2 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-100 of Human CPT2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:WFDKSFNLIIAKDGSTAVHFEHSWGDGVAVLRFFNEVFKDSTQTPAVTPQSQPATTDSTVTVQKLNFELTDALKTGITAAKEKFDATMKTLTIDCVQFQR

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CPT2

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CPT2 Protein

  • carnitine O-palmitoyltransferase 2, mitochondrial
  • carnitine palmitoyltransferase 2
  • Carnitine palmitoyltransferase IIEC 2.3.1.21
  • CPT II
  • CPT1
  • CPTASE

Background

CPT2 - carnitine palmitoyltransferase II

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-53791
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-06672
Species: Hu
NBP1-84975
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF6898
Species: Hu, Mu, Rt
Applications: WB
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22127
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-59576
Species: Hu
Applications: WB, IHC
AF2850
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP1-87487
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54378
Species: Hu
Applications: WB, ICC/IF, IHC
NBP2-57222
Species: Hu
Applications: ICC/IF
NB400-144
Species: Hu, Mu, Rt, Po, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for CPT2 Partial Recombinant Protein (H00001376-Q01) (0)

There are no publications for CPT2 Partial Recombinant Protein (H00001376-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CPT2 Partial Recombinant Protein (H00001376-Q01) (0)

There are no reviews for CPT2 Partial Recombinant Protein (H00001376-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CPT2 Partial Recombinant Protein (H00001376-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CPT2 Products

Bioinformatics Tool for CPT2 Partial Recombinant Protein (H00001376-Q01)

Discover related pathways, diseases and genes to CPT2 Partial Recombinant Protein (H00001376-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CPT2 Partial Recombinant Protein (H00001376-Q01)

Discover more about diseases related to CPT2 Partial Recombinant Protein (H00001376-Q01).
 

Pathways for CPT2 Partial Recombinant Protein (H00001376-Q01)

View related products by pathway.

PTMs for CPT2 Partial Recombinant Protein (H00001376-Q01)

Learn more about PTMs related to CPT2 Partial Recombinant Protein (H00001376-Q01).

Blogs on CPT2

There are no specific blogs for CPT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CPT2 Antibody
H00001376-B01P

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CPT2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CPT2