Recombinant Human CPT1A Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CPT1A Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-90 of Human CPT1A partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:VFKNGKMGLNAEHSWADAPIVAHLWEYVMSIDSLQLGYAEDGHCKGDINPNIPYPTRLQWDIPGECQEVIETSLNTANLLANDVDFHSFP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CPT1A

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CPT1A Protein

  • carnitine O-palmitoyltransferase 1, liver isoform
  • Carnitine O-palmitoyltransferase I, liver isoform
  • carnitine palmitoyltransferase 1A (liver)
  • Carnitine palmitoyltransferase 1A
  • carnitine palmitoyltransferase I, liver
  • CPT I
  • CPT1
  • CPT1-LEC 2.3.1.21
  • CPTI-L
  • EC 2.3.1
  • L-CPT1

Background

The mitochondrial oxidation of long-chain fatty acids is initiated by the sequential action of carnitine palmitoyltransferase I (which is located in the outer membrane and is detergent-labile) and carnitine palmitoyltransferase II (which is located in the inner membrane and is detergent-stable), together with a carnitine-acylcarnitine translocase. CPT I is the key enzyme in the carnitine-dependent transport across the mitochondrial inner membrane and its deficiency results in a decreased rate of fatty acid beta-oxidation. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
H00001376-B01P
Species: Hu
Applications: WB
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF6898
Species: Hu, Mu, Rt
Applications: WB
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59576
Species: Hu
Applications: WB, IHC
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB400-144
Species: Hu, Mu, Rt, Po, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-22127
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
AF2850
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP1-87487
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84975
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-06672
Species: Hu
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NB100-2564
Species: Hu
Applications: WB
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for CPT1A Partial Recombinant Protein (H00001374-Q01) (0)

There are no publications for CPT1A Partial Recombinant Protein (H00001374-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CPT1A Partial Recombinant Protein (H00001374-Q01) (0)

There are no reviews for CPT1A Partial Recombinant Protein (H00001374-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CPT1A Partial Recombinant Protein (H00001374-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CPT1A Products

Bioinformatics Tool for CPT1A Partial Recombinant Protein (H00001374-Q01)

Discover related pathways, diseases and genes to CPT1A Partial Recombinant Protein (H00001374-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CPT1A Partial Recombinant Protein (H00001374-Q01)

Discover more about diseases related to CPT1A Partial Recombinant Protein (H00001374-Q01).
 

Pathways for CPT1A Partial Recombinant Protein (H00001374-Q01)

View related products by pathway.

PTMs for CPT1A Partial Recombinant Protein (H00001374-Q01)

Learn more about PTMs related to CPT1A Partial Recombinant Protein (H00001374-Q01).
 

Research Areas for CPT1A Partial Recombinant Protein (H00001374-Q01)

Find related products by research area.

Blogs on CPT1A

There are no specific blogs for CPT1A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CPT1A Antibody
NB100-53791

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CPT1A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CPT1A