Recombinant Human COX8A Protein

Images

 
SDS-Page: COX8A Recombinant Protein [H00001351-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human COX8A Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-69 of Human COX8A full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSVLTPLLLRGLTGSARRLPVPRAKIHSLPPEGKLGIMELAVGLTSCFVTFLLPAGWILSHLETYRRPE

Protein/Peptide Type
Recombinant Protein
Gene
COX8A

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human COX8A Protein

  • COX
  • COX8-2
  • COX8cytochrome c oxidase subunit VIII
  • COX8Lcytochrome c oxidase subunit 8A (ubiquitous)
  • Cytochrome c oxidase polypeptide VIII-liver/heart
  • Cytochrome c oxidase subunit 8-2
  • cytochrome c oxidase subunit 8A, mitochondrial
  • cytochrome c oxidase subunit VIIIA (ubiquitous)
  • VIII
  • VIII-L

Background

The protein encoded by this gene is the terminal enzyme of the respiratory chain, coupling the transfer of electrons from cytochrome c to molecular oxygen, with the concomitant production of a proton electrochemical gradient across the inner mitochondrial membrane. In addition to 3 mitochondrially encoded subunits, which perform the catalytic function, the eukaryotic enzyme contains nuclear-encoded smaller subunits, ranging in number from 4 in some organisms to 10 in mammals. It has been proposed that nuclear-encoded subunits may be involved in the modulation of the catalytic function. This gene encodes one of the nuclear-encoded subunits. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-85500
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85500
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87852
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NB110-58748
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
H00001351-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for COX8A Recombinant Protein (H00001351-P01) (0)

There are no publications for COX8A Recombinant Protein (H00001351-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COX8A Recombinant Protein (H00001351-P01) (0)

There are no reviews for COX8A Recombinant Protein (H00001351-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for COX8A Recombinant Protein (H00001351-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional COX8A Products

Bioinformatics Tool for COX8A Recombinant Protein (H00001351-P01)

Discover related pathways, diseases and genes to COX8A Recombinant Protein (H00001351-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on COX8A

There are no specific blogs for COX8A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

COX8A Antibody
NBP2-30764

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human COX8A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol COX8A