COX7B Antibody


Immunohistochemistry-Paraffin: COX7B Antibody [NBP2-31703] - Staining of human hippocampus shows strong cytoplasmic and nuclear positivity in neuronal cells.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

COX7B Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: MFPLVKSALNRLQVRSIQQTMARQSHQKRTPDF
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
COX7B Protein (NBP2-31703PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for COX7B Antibody

  • Cytochrome c oxidase polypeptide VIIb
  • cytochrome c oxidase subunit 7B, mitochondrial
  • cytochrome c oxidase subunit VIIb
  • cytochrome-c oxidase chain VIIb


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
Species: Hu
Applications: WB, IHC, IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Dr, I, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu
Applications: IHC, IHC-P

Publications for COX7B Antibody (NBP2-31703) (0)

There are no publications for COX7B Antibody (NBP2-31703).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COX7B Antibody (NBP2-31703) (0)

There are no reviews for COX7B Antibody (NBP2-31703). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for COX7B Antibody (NBP2-31703) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional COX7B Products

Bioinformatics Tool for COX7B Antibody (NBP2-31703)

Discover related pathways, diseases and genes to COX7B Antibody (NBP2-31703). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COX7B Antibody (NBP2-31703)

Discover more about diseases related to COX7B Antibody (NBP2-31703).

Pathways for COX7B Antibody (NBP2-31703)

View related products by pathway.

PTMs for COX7B Antibody (NBP2-31703)

Learn more about PTMs related to COX7B Antibody (NBP2-31703).

Blogs on COX7B

There are no specific blogs for COX7B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our COX7B Antibody and receive a gift card or discount.


Gene Symbol COX7B