COX5b Antibody (1E8) - Azide and BSA Free

Western Blot: COX5b Antibody (1E8) [H00001329-M03] - Analysis of COX5B expression in HepG2 (Cat # L019V1).

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 1E8
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

COX5b Antibody (1E8) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: COX5B (NP_001853, 37 a.a. ~ 128 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VPTDEEQATGLEREIMLAAKKGLDPYNVLAPKGASGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWLHKGEAQRCPRCGAHYKLVPQQLA
• Specificity: COX5B - cytochrome c oxidase subunit Vb
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: COX5B
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for COX5b Antibody (1E8) - Azide and BSA Free

• COXVB
• Cytochrome c oxidase polypeptide Vb
• cytochrome c oxidase polypeptide VB, mitochondrial
• cytochrome c oxidase subunit 5B, mitochondrial
• cytochrome c oxidase subunit Vb

Background

Cytochrome C oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradient across the inner mitochondrial membrane. The complex consists of 13 mitochondrial- and nuclear-encoded subunits. The mitochondrially-encoded subunits perform the electron transfer and proton pumping activities. The functions of the nuclear-encoded subunits are unknown but they may play a role in the regulation and assembly of the complex. This gene encodes the nuclear-encoded subunit Vb of the human mitochondrial respiratory chain enzyme.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for COX5b Antibody (H00001329-M03)(1)

Publication using H00001329-M03

• Halbert D, Domenyuk V, Spetzler D et al. Aptamers and uses thereof United States Patent Application US 9958448 B2 2018-01-01

Bioinformatics

• Gene Symbol: COX5B
• Entrez:
  • 1329(Human)
• OMIM:
  • 123866(Human)
• Uniprot:
  • NP_001853(Human)