COX4 Antibody (CL3515)

Images

 
Western Blot: COX4 Antibody (CL3515) [NBP2-61620] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line HeLaLane 3: Human cell line HEK 293Lane 4: Human cell line A-431Lane 5: Human cell ...read more
Immunohistochemistry-Paraffin: COX4 Antibody (CL3515) [NBP2-61620] - Staining of human skin shows strong cytoplasmic immunoreactivity in epithelial cells.
Immunohistochemistry: COX4 Antibody (CL3515) [NBP2-61620] - Staining of human prostate shows strong cytoplasmic immunoreactivity in epithelial cells.
Immunohistochemistry: COX4 Antibody (CL3515) [NBP2-61620] - Staining of human placenta shows strong cytoplasmic immunoreactivity in trophoblasts.
Immunohistochemistry: COX4 Antibody (CL3515) [NBP2-61620] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Immunohistochemistry: COX4 Antibody (CL3515) [NBP2-61620] - Staining of human fallopian tube shows strong cytoplasmic immunoreactivity in epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clone
CL3515
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

COX4 Antibody (CL3515) Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKT
Epitope
RDHPLPEVAH
Specificity
Specificity of human COX4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
COX4I1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1 ug/ml
  • Immunohistochemistry 1:5000 - 1:10000
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000

Reactivity Notes

Expected species cross reactivity based on sequence identity: Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for COX4 Antibody (CL3515)

  • COX IV-1
  • COX4
  • COX4-1
  • COX4COXIV
  • COX4I2
  • Cytochrome c oxidase polypeptide IV
  • cytochrome c oxidase subunit 4 isoform 1, mitochondrial
  • cytochrome c oxidase subunit IV isoform 1cytochrome c oxidase subunit IV
  • MGC72016

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Dr, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NBP2-65875
Species: Hu
NBP2-59438
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-75597
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-71648
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00084701-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-67643
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-13878
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-04676
Species: Hu, Mu, Rt, Ha, Sq
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-89499
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-39057
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-20460
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, ChIP
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NBP1-77397
Species: Hu, Mu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP2-61620
Species: Hu
Applications: WB, IHC, IHC-P

Publications for COX4 Antibody (NBP2-61620) (0)

There are no publications for COX4 Antibody (NBP2-61620).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COX4 Antibody (NBP2-61620) (0)

There are no reviews for COX4 Antibody (NBP2-61620). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for COX4 Antibody (NBP2-61620) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for COX4 Antibody (NBP2-61620)

Discover related pathways, diseases and genes to COX4 Antibody (NBP2-61620). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COX4 Antibody (NBP2-61620)

Discover more about diseases related to COX4 Antibody (NBP2-61620).
 

Pathways for COX4 Antibody (NBP2-61620)

View related products by pathway.

PTMs for COX4 Antibody (NBP2-61620)

Learn more about PTMs related to COX4 Antibody (NBP2-61620).
 

Research Areas for COX4 Antibody (NBP2-61620)

Find related products by research area.

Blogs on COX4.

The Importance of the COX IV Antibody to Apoptosis Research
COX IV isoform 1 is a nuclear-encoded polypeptide chain of the Cytochrome C Oxidase enzyme, located on the mitochondrial inner membrane. Owing to its widespread distribution in human and mammalian tissues, COX IV antibodies are widely used as loading...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our COX4 Antibody (CL3515) and receive a gift card or discount.

Bioinformatics

Gene Symbol COX4I1