COX15 Antibody (2D2)

Images

 
Western Blot: COX15 Antibody (2D2) [H00001355-M01] - Analysis of COX15 expression in transfected 293T cell line by COX15 monoclonal antibody (M01), clone 2D2.Lane 1: COX15 transfected lysate (Predicted MW: 46 KDa).Lane ...read more
Sandwich ELISA: COX15 Antibody (2D2) [H00001355-M01] - Detection limit for recombinant GST tagged COX15 is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2D2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

COX15 Antibody (2D2) Summary

Immunogen
COX15 (NP_510870, 92 a.a. - 152 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LTESGLSMVDWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLTEFKFIWYMEYSH
Specificity
COX15 - COX15 homolog, cytochrome c oxidase assembly protein (yeast) (2D2)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
COX15
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for COX15 Antibody (2D2)

  • COX15 (yeast) homolog, cytochrome c oxidase assembly protein
  • COX15 homolog, cytochrome c oxidase assembly protein (yeast)
  • cytochrome c oxidase assembly protein COX15 homolog
  • cytochrome c oxidase subunit 15
  • EC 1.4.4.2
  • EC 3.1.3.5

Background

Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes a protein which is not a structural subunit, but may be essential for the biogenesis of COX formation and may function in the hydroxylation of heme O, according to the yeast mutant studies. This protein is predicted to contain 5 transmembrane domains localized in the mitochondrial inner membrane. Alternative splicing of this gene generates two transcript variants diverging in the 3' region. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86322
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-59438
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-30764
Species: Hu
Applications: IHC, IHC-P
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00006834-T01
Species: Hu
NBP1-77274
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP1-77273
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
H00001353-B02P
Species: Hu
Applications: WB, ICC/IF
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-85500
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-123
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-116
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA
NBP1-56518
Species: Hu
Applications: WB
NB110-74569
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-46127
Species: Hu
Applications: WB, IHC
NBP2-30388
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24470
Species: Hu
Applications: WB, Simple Western, IHC-P
NBP1-82653
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF885
Species: Hu
Applications: WB, IHC

Publications for COX15 Antibody (H00001355-M01) (0)

There are no publications for COX15 Antibody (H00001355-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COX15 Antibody (H00001355-M01) (0)

There are no reviews for COX15 Antibody (H00001355-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for COX15 Antibody (H00001355-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional COX15 Products

Bioinformatics Tool for COX15 Antibody (H00001355-M01)

Discover related pathways, diseases and genes to COX15 Antibody (H00001355-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COX15 Antibody (H00001355-M01)

Discover more about diseases related to COX15 Antibody (H00001355-M01).
 

Pathways for COX15 Antibody (H00001355-M01)

View related products by pathway.

PTMs for COX15 Antibody (H00001355-M01)

Learn more about PTMs related to COX15 Antibody (H00001355-M01).

Blogs on COX15

There are no specific blogs for COX15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our COX15 Antibody (2D2) and receive a gift card or discount.

Bioinformatics

Gene Symbol COX15
Entrez
Uniprot