COX10 Antibody - BSA Free

Western Blot: COX10 Antibody [NBP1-59554] - Middle region validated by WB using mouse mitochondria at 1:1000.

Western Blot: COX10 Antibody [NBP1-59554] - This Anti-COX10 antibody was used in Western Blot of Fetal Lung tissue lysate at a concentration of 1ug/ml.

Western Blot: COX10 Antibody [NBP1-59554] - Middle region validated by WB using mouse mitochondria at 1:1000.

• Reactivity: Hu, Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

COX10 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to COX10(COX10 homolog, cytochrome c oxidase assembly protein, heme A) The peptide sequence was selected from the middle region of COX10. Peptide sequence APGPFDWPCFLLTSVGTGLASCAANSINQFFEVPFDSNMNRTKNRPLVRG. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: COX10
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for COX10 Antibody - BSA Free

• COX10 (yeast) homolog, cytochrome c oxidase assembly protein (heme A:farnesyltransferase)
• COX10 homolog, cytochrome c oxidase assembly protein, heme A:farnesyltransferase (yeast)
• cytochrome c oxidase assembly protein
• cytochrome c oxidase subunit X
• EC 2.5.1.-
• heme A: farnesyltransferase
• Heme O synthase
• protoheme IX farnesyltransferase, mitochondrial

Background

Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. COX10 is heme A: farnesyltransferase, which is not a structural subunit but required for the expression of functional COX and functions in the maturation of the heme A prosthetic group of COX. This protein is predicted to contain 7-9 transmembrane domains localized in the mitochondrial inner membrane. A gene mutation, which results in the substitution of a lysine for an asparagine (N204K), is identified to be responsible for cytochrome c oxidase deficiency. In addition, this gene is disrupted in patients with CMT1A (Charcot-Marie-Tooth type 1A) duplication and with HNPP (hereditary neuropathy with liability to pressure palsies) deletion.Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes heme A:farnesyltransferase, which is not a structural subunit but required for the expression of functional COX and functions in the maturation of the heme A prosthetic group of COX. This protein is predicted to contain 7-9 transmembrane domains localized in the mitochondrial inner membrane. A gene mutation, which results in the substitution of a lysine for an asparagine (N204K), is identified to be responsible for cytochrome c oxidase deficiency. In addition, this gene is disrupted in patients with CMT1A (Charcot-Marie-Tooth type 1A) duplication and with HNPP (hereditary neuropathy with liability to pressure palsies) deletion. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for COX10 Antibody (NBP1-59554)(1)

Publication using NBP1-59554

• Nsiah NY, Inman DM. Destabilizing COXIV in M�ller Glia Increases Retinal Glycolysis and Alters Scotopic Electroretinogram Cells 2022-11-24 [PMID: 36497016] (Immunocytochemistry/ Immunofluorescence)

Bioinformatics

• Gene Symbol: COX10
• Uniprot:
  • Q12887(Human)