Cortactin Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

Cortactin Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CTTN.
  
  

  Source: E. coli

  Amino Acid Sequence: GFGGKFGVQTDRQDKCALGWDHQEKLQLHESQKDYKTGFGGKFGVQSERQDSAAVGFDYKEKLAKHESQQDYSKGF

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: CTTN
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38826.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 26 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Cortactin Recombinant Protein Antigen

• 1110020L01Rik
• Amplaxin
• Cortactin
• CTTN
• ems1 sequence (mammary tumor and squamous cell carcinoma-associated (p80/85 srcsubstrate)
• EMS1
• EMS1amplaxin
• FLJ34459
• Oncogene EMS1
• src substrate cortactin

Background

Immunocytochemistry reveals that in epithelial cells, the human cortactin protein is localized mainly in the cytoplasm and, to a very low extent, in protruding leading lamellae of the cell. However, in carcinoma cells that constitutively overexpress cortactin accumulates in the podosome-like adherens junctions associated with the cell-substratum contact sites. Overexpression and concomitant accumulation of the Cortactin protein in the cell-substratum contact sites might, therefore, contribute to the invasive potential of these tumor cells (1). In cells derived from breast carcinomas and squamous carcinomas of the head and neck, DNA amplification of a particular tyrosine kinase substrate region results in overexpression of cortactin. Overexpression is accompanied by a partial redistribution of cortactin from the cytoplasm into cell-matrix contact sites (2).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: CTTN