Home » Cortactin » Cortactin Antibodies » Cortactin Antibody (2B5)

Cortactin Antibody (2B5)

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: Cortactin Antibody (2B5) [H00002017-M01] - Analysis of CTTN expression in transfected 293T cell line by CTTN monoclonal antibody (M01), clone 2B5.Lane 1: CTTN transfected lysate (Predicted MW: 57.5 KDa).Lane 2: Non-transfected lysate.
Western Blot: Cortactin Antibody (2B5) [H00002017-M01] - Analysis of CTTN expression in transfected 293T cell line by CTTN monoclonal antibody (M01), clone 2B5.Lane 1: CTTN transfected lysate (Predicted MW: 57.5 ...read more
Proximity Ligation Assay: Cortactin Antibody (2B5) [H00002017-M01] - Analysis of protein-protein interactions between SYK and CTTN. HeLa cells were stained with anti-SYK rabbit purified polyclonal 1:1200 and anti-CTTN ...read more
Sandwich ELISA: Cortactin Antibody (2B5) [H00002017-M01] - Detection limit for recombinant GST tagged CTTN is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PLA, S-ELISA
Clone
2B5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Cortactin Antibody (2B5) Summary

Immunogen
CTTN (NP_005222.2, 341 a.a. ~ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EAVTSKTSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVYEDAASFKAELSYRGPVSGTEPEPVYSMEA
Specificity
CTTN - cortactin (2B5)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CTTN
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Proximity Ligation Assay
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00002017-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cortactin Antibody (2B5)

  • 1110020L01Rik
  • Amplaxin
  • Cortactin
  • CTTN
  • ems1 sequence (mammary tumor and squamous cell carcinoma-associated (p80/85 srcsubstrate)
  • EMS1
  • EMS1amplaxin
  • FLJ34459
  • Oncogene EMS1
  • src substrate cortactin

Background

This gene is overexpressed in breast cancer and squamous cell carcinomas of the head and neck. The encoded protein is localized in the cytoplasm and in areas of the cell-substratum contacts. This gene has two roles: (1) regulating the interactions between components of adherens-type junctions and (2) organizing the cytoskeleton and cell adhesion structures of epithelia and carcinoma cells. During apoptosis, the encoded protein is degraded in a caspase-dependent manner. The aberrant regulation of this gene contributes to tumor cell invasion and metastasis. Two splice variants that encode different isoforms have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western blot shows lysates of MDA‑MB‑468 human breast cancer cell line and HepG2 human hepatocellular carcinoma cell line untreated (-) or treated (+) with 50 μM pervanadate (PV) for 10 minutes. PVDF membrane was probed with 1 µg/mL of Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Src (Y419) at approximately 56 - 61 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MBA‑MB‑468 human breast cancer cell line untreated (-) or treated (+) with 50 µM Pervanadate (PV) for 10 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Src (Y419) at approximately 64 kDa (as indicated) using 10 µg/mL of Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Src phosphorylated at Y419 was detected in immersion fixed paraffin-embedded sections of human colon using Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). Specific labeling was localized to the cytoplasm of epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Review)
(6 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
ACTR2 Antibody
(1B10-C4)
H00010097-M01
Western Blot: ACTR2 Antibody (1B10-C4) [H00010097-M01] - Western Blot analysis of ACTR2 expression in A-431 ( Cat # L015V1 ).
Immunohistochemistry-Paraffin: ACTR2 Antibody (1B10-C4) [H00010097-M01] - Analysis of monoclonal antibody to ACTR2 on formalin-fixed paraffin-embedded human kidney. Antibody concentration 3 ug/ml.
Sandwich ELISA: ACTR2 Antibody (1B10-C4) [H00010097-M01] - Detection limit for recombinant GST tagged ACTR2 is approximately 0.03ng/ml as a capture antibody.
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Cyclin D1 Antibody
(SPM587)
NBP2-32840
Western Blot: Cyclin D1 Antibody (SPM587) [NBP2-32840] - HELLS expression and protein levels are modulated with YAP1/TEAD inhibition downstream of SHH signaling. Western blot showing protein levels of HELLS, cleaved caspase 3 (CC3), and Cyclin D1 in verteporfin treated CGNPs. Blot is representative of three replicates. Full-length blots are presented in Supplementary Fig. S4. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-019-50088-1), licensed under a CC-BY licence.
Flow Cytometry: Cyclin D1 Antibody (SPM587) [NBP2-32840] - Flow Cytometric analysis of human Cyclin D1 on Jurkat cells. Black: cells alone; Green: Isotype Control; Red: PE-labeled Cyclin D1 Monoclonal Antibody (SPM587).
Flow Cytometry: Cyclin D1 Antibody (SPM587) [NBP2-32840] - Flow Cytometric analysis of human Cyclin D1 on MCF-7 cells. Black: cells alone; Green: Isotype Control; Red: PE-labeled Cyclin D1 Monoclonal Antibody (SPM587).
(1 Review)
(8 Publications)
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Angiopoietin-like
Protein 2/ANGPTL2 Ant ...
AF1444
Western blot shows lysates of mouse uterus tissue and MEF mouse embryonic feeder cells. PVDF membrane was probed with 2 µg/mL of Goat Anti-Mouse Angiopoietin‑like Protein 2/ANGPTL2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1444) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Angiopoietin‑like Protein 2/ANGPTL2 at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(2 Publications)
Species: Mu
Applications: IHC, WB
AICDA Antibody
NBP1-30955
Immunocytochemistry/Immunofluorescence: AICDA Antibody [NBP1-30955] - Analysis of methanol-fixed HeLa, using antibody at 1:500 dilution.
Immunohistochemistry-Paraffin: AICDA Antibody [NBP1-30955] - Paraffin-embedded Cal27 xenograft, using antibody at 1:500 dilution.
Western Blot: AICDA Antibody [NBP1-30955] - Sample (30 ug of whole cell lysate) A: 293T 12% SDS PAGE, antibody diluted at 1:500.
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
ACTR3 Antibody
(8K4F2)
NBP3-16424
Immunohistochemistry-Paraffin: ACTR3 Antibody (8K4F2) [NBP3-16424] - Immunohistochemistry of paraffin-embedded rat kidney using ACTR3 Rabbit mAb (NBP3-16424) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: ACTR3 Antibody (8K4F2) [NBP3-16424] - Immunohistochemistry of paraffin-embedded human appendix using ACTR3 Rabbit mAb (NBP3-16424) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: ACTR3 Antibody (8K4F2) [NBP3-16424] - Immunohistochemistry of paraffin-embedded mouse spleen using ACTR3 Rabbit mAb (NBP3-16424) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
FAK Antibody
(SR46-04)
NBP2-67327
Flow Cytometry: FAK Antibody (SR46-04) [NBP2-67327] - Analysis of Hela cells with FAK antibody at 1/50 dilution (blue) compared with an unlabelled control (cells without incubation with primary antibody; red). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunocytochemistry/Immunofluorescence: FAK Antibody (SR46-04) [NBP2-67327] - Staining FAK in SH-SY-5Y cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: FAK Antibody (SR46-04) [NBP2-67327] - Analysis of paraffin-embedded human spleen tissue using anti-FAK antibody. Counter stained with hematoxylin.
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
EGFR Antibody
[Unconjugated]
AF231
EGFR was detected in immersion fixed frozen sections of human skin using Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) at 1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to plasma membrane. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
EGFR was detected in immersion fixed A431 human epithelial carcinoma cell line using Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) at 1 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to plasma membrane. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line and MDA‑MB‑231 human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for EGFR at approximately 175 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(15 Publications)
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
N-WASP Antibody
NBP1-82512
Immunocytochemistry/Immunofluorescence: N-WASP Antibody [NBP1-82512] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: N-WASP Antibody [NBP1-82512] - Staining of human cerebral cortex shows moderate to strong positivity in neuronal cells.
Immunohistochemistry-Paraffin: N-WASP Antibody [NBP1-82512] - Staining of human kidney shows moderate to strong positivity in cells in tubules and glomeruli.
(5 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
FGF-3
[Unconjugated]
1206-F3/CF
FGF-3 [Unconjugated]
(11 Publications)
Species: Hu
Applications: BA
AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Serum-starved MCF‑7 human breast cancer cells were unstimulated (light orange filled histogram) or activated with 100 ng/mL Recombinant human IGF-1 (Catalog # 291-G1, dark orange filled histogram) for 15 minutes, then stained with Rabbit Anti-Human/Mouse/Rat Phospho‑Akt (S473) Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF887) or control antibody (Catalog # AB-105-C, open histogram), followed by Allophycocyanin-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # F0111). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
(28 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
WASP Antibody
NB300-996
Immunohistochemistry-Paraffin: WASP Antibody [NB300-996] - Staining of paraffin embedded Human Spleen. Antibody at 5 ug/mL. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Immunocytochemistry/Immunofluorescence: WASP Antibody [NB300-996] - Immunofluorescence analysis of paraformaldehyde fixed HepG2 cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing nuclear and cytoplasmic staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL).
Immunocytochemistry/Immunofluorescence: WASP Antibody [NB300-996] - Immunofluorescence analysis of paraformaldehyde fixed U2OS cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing nuclear and cytoplasmic staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL).
(1 Publication)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
EGF [Unconjugated]
236-EG
1 µg/lane of Recombinant Human EGF was resolved with SDS-PAGE  and visualized by silver staining under reducing (R) conditions, showing a single band at 6 kDa.
Recombinant Human EGF (Catalog # 236‑EG) stimulates cell proliferation of the Balb/3T3 mouse embryonic fibroblast cell line. The ED50 for this effect is 20‑100 pg/mL.
(668 Publications)
Species: Hu
Applications: BA
Paxillin Antibody
(SY23-02)
NBP2-67427
Immunocytochemistry/Immunofluorescence: Paxillin Antibody (SY23-02) [NBP2-67427] - Staining Paxillin in A549 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: Paxillin Antibody (SY23-02) [NBP2-67427] - Staining Paxillin in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: Paxillin Antibody (SY23-02) [NBP2-67427] - Staining Paxillin in SKOV-3 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
FGF-4
[Unconjugated]
7460-F4/CF
FGF-4 [Unconjugated]
(2 Publications)
Species: Hu
Applications: BA
HCLS1 Antibody
(1A8)
H00003059-M02
Western Blot: HCLS1 Antibody (1A8) [H00003059-M02] - Analysis of HCLS1 expression in transfected 293T cell line by HCLS1 monoclonal antibody (M02), clone 1A8.Lane 1: HCLS1 transfected lysate(54 KDa).Lane 2: Non-transfected lysate.
Proximity Ligation Assay: HCLS1 Antibody (1A8) [H00003059-M02] - Analysis of protein-protein interactions between CASP3 and HCLS1. HeLa cells were stained with anti-CASP3 rabbit purified polyclonal 1:1200 and anti-HCLS1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Immunohistochemistry-Paraffin: HCLS1 Antibody (1A8) [H00003059-M02] - Analysis of monoclonal antibody to HCLS1 on formalin-fixed paraffin-embedded human tonsil. Antibody concentration 3 ug/ml.
Species: Hu
Applications: ELISA, IHC, IHC-P, KD, PLA, S-ELISA, WB
Rac1 Antibody
NB100-91266
Western Blot: Rac1 Antibody [NB100-91266] - WB on tissue lysates. Blocking: 1% LFDM for 30 min at RT; primary antibody dilution: 1:1000 incubated overnight at 4C.
Immunohistochemistry: Rac1 Antibody [NB100-91266] - Rat spinal cord (ventral horn) using Rabbit antibody to RAC1, RAC2 whole serum at 1:1000 dilution. Pre-absorption of the antibody with the immunizing peptide completely abolishes the immunostaining (not shown).
Immunohistochemistry: Rac1 Antibody [NB100-91266] - Rat ligated sciatic nerve using Rabbit antibody to RAC1, RAC2 whole serum at 1:1000 dilution. Pre-absorption of the antibody with the immunizing peptide completely abolishes the immunostaining (not shown).
(1 Review)
(5 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
SHANK2 Antibody
(N23b/49)
NBP2-12913
Western Blot: SHANK2 Antibody (N23b/49) [NBP2-12913] - Western Blot analysis of Rat brain membrane lysate showing detection of SHANK2 protein using Mouse Anti-SHANK2 Monoclonal Antibody, Clone S23b-49 (NBP2-12913). Load: 15 ug. Block: 1.5% BSA for 30 minutes at RT. Primary Antibody: Mouse Anti-SHANK2 Monoclonal Antibody (NBP2-12913) at 1:1000 for 2 hours at RT. Secondary Antibody: Sheep Anti-Mouse IgG: HRP for 1 hour at RT.
Immunocytochemistry/Immunofluorescence: SHANK2 Antibody (N23b/49) [NBP2-12913] - Immunocytochemistry/Immunofluorescence analysis using Mouse Anti-SHANK2 (pan) Monoclonal Antibody, Clone S23b-49 (NBP2-12913). Tissue: Neuroblastoma cell line (SK-N-BE). Species: Human. Fixation: 4% Formaldehyde for 15 min at RT. Primary Antibody: Mouse Anti-SHANK2 (pan) Monoclonal Antibody (NBP2-12913) at 1:100 for 60 min at RT. Secondary Antibody: Goat Anti-Mouse ATTO 488 at 1:200 for 60 min at RT. Counterstain: Phalloidin Texas Red F-Actin stain; DAPI (blue) nuclear stain at 1:1000, 1:5000 for 60 min at RT, 5 min at RT. Localization: Cytoplasm . Magnification: 60X. (A) DAPI (blue) nuclear stain. (B) Phalloidin Texas Red F-Actin stain. (C) SHANK2 (pan) Antibody. (D) Composite.
Immunocytochemistry/Immunofluorescence: SHANK2 Antibody (N23b/49) [NBP2-12913] - Immunocytochemistry/Immunofluorescence analysis using Mouse Anti-SHANK2 (pan) Monoclonal Antibody, Clone S23b-49 (NBP2-12913). Tissue: Neuroblastoma cells (SH-SY5Y). Species: Human. Fixation: 4% PFA for 15 min. Primary Antibody: Mouse Anti-SHANK2 (pan) Monoclonal Antibody (NBP2-12913) at 1:50 for overnight at 4C with slow rocking. Secondary Antibody: AlexaFluor 488 at 1:1000 for 1 hour at RT. Counterstain: Phalloidin-iFluor 647 (red) F-Actin stain; Hoechst (blue) nuclear stain at 1:800, 1.6mM for 20 min at RT. (A) Hoechst (blue) nuclear stain. (B) Phalloidin-iFluor 647 (red) F-Actin stain. (C) SHANK2 (pan) Antibody (D) Composite.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
ERK1 Antibody (1E5)
NBP2-22203
Flow Cytometry: ERK1 Antibody (1E5) [NBP2-22203] - Flow cytometric analysis of Hela cells using ERK1 mouse mAb (blue) and negative control (red).
Immunocytochemistry/Immunofluorescence: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of NIH/3T3 cells using ERK1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of paraffin-embedded bladder cancer tissues using ERK1 mouse mAb with DAB staining.
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
ERK2 Antibody
(OTI6E5)
NBP1-47842
Immunohistochemistry-Paraffin: ERK2 Antibody (6E5) [NBP1-47842] - Endometrium tissue within the normal limits using antiMAPK1mouse monoclonal antibody. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 100C for 10min,Dilution 1:50)
Immunoprecipitation: ERK2 Antibody (6E5) [NBP1-47842] - TrueMab monoclonal anti-ERK2 antibody (Negative control: IP without adding anti-ERK2 antibody). For each experiment, 500ul of DDK tagged ERK2 overexpression lysates (at 1:5 dilution with HEK293T lysate), 2ug of antibody.
Immunohistochemistry-Paraffin: ERK2 Antibody (6E5) [NBP1-47842] - Staining of paraffin-embedded Adenocarcinoma of colon tissue using anti-ERK2 mouse monoclonal antibody.
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB

Publications for Cortactin Antibody (H00002017-M01)(1)


Showing Publication 1 - 1 of 1.
Publication using H00002017-M01 Applications Species
Halbert D, Domenyuk V, Spetzler D et al. Aptamers and uses thereof United States Patent Application US 9958448 B2 2018

Reviews for Cortactin Antibody (H00002017-M01) (0)

There are no reviews for Cortactin Antibody (H00002017-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cortactin Antibody (H00002017-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cortactin Products

Bioinformatics Tool for Cortactin Antibody (H00002017-M01)

Discover related pathways, diseases and genes to Cortactin Antibody (H00002017-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cortactin Antibody (H00002017-M01)

Discover more about diseases related to Cortactin Antibody (H00002017-M01).
 

Pathways for Cortactin Antibody (H00002017-M01)

View related products by pathway.

PTMs for Cortactin Antibody (H00002017-M01)

Learn more about PTMs related to Cortactin Antibody (H00002017-M01).
 

Research Areas for Cortactin Antibody (H00002017-M01)

Find related products by research area.

Blogs on Cortactin

There are no specific blogs for Cortactin, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cortactin Antibody (2B5) and receive a gift card or discount.


Bioinformatics

Gene Symbol CTTN
Entrez
Uniprot