Cortactin Antibody (2B5)

Images

 
Western Blot: Cortactin Antibody (2B5) [H00002017-M01] - Analysis of CTTN expression in transfected 293T cell line by CTTN monoclonal antibody (M01), clone 2B5.Lane 1: CTTN transfected lysate (Predicted MW: 57.5 ...read more
Proximity Ligation Assay: Cortactin Antibody (2B5) [H00002017-M01] - Analysis of protein-protein interactions between SYK and CTTN. HeLa cells were stained with anti-SYK rabbit purified polyclonal 1:1200 and anti-CTTN ...read more
Sandwich ELISA: Cortactin Antibody (2B5) [H00002017-M01] - Detection limit for recombinant GST tagged CTTN is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PLA, S-ELISA
Clone
2B5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Cortactin Antibody (2B5) Summary

Immunogen
CTTN (NP_005222.2, 341 a.a. ~ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EAVTSKTSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVYEDAASFKAELSYRGPVSGTEPEPVYSMEA
Specificity
CTTN - cortactin (2B5)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CTTN
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Proximity Ligation Assay
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00002017-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cortactin Antibody (2B5)

  • 1110020L01Rik
  • Amplaxin
  • Cortactin
  • CTTN
  • ems1 sequence (mammary tumor and squamous cell carcinoma-associated (p80/85 srcsubstrate)
  • EMS1
  • EMS1amplaxin
  • FLJ34459
  • Oncogene EMS1
  • src substrate cortactin

Background

This gene is overexpressed in breast cancer and squamous cell carcinomas of the head and neck. The encoded protein is localized in the cytoplasm and in areas of the cell-substratum contacts. This gene has two roles: (1) regulating the interactions between components of adherens-type junctions and (2) organizing the cytoskeleton and cell adhesion structures of epithelia and carcinoma cells. During apoptosis, the encoded protein is degraded in a caspase-dependent manner. The aberrant regulation of this gene contributes to tumor cell invasion and metastasis. Two splice variants that encode different isoforms have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2685
Species: Hu
Applications: IHC, Simple Western, WB
H00010097-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NBP2-32840
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF1444
Species: Mu
Applications: IHC, WB
NBP1-30955
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-16424
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67327
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
AF231
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NBP1-82512
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
1206-F3/CF
Species: Hu
Applications: BA
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NB300-996
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
236-EG
Species: Hu
Applications: BA
NBP2-67427
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
7460-F4/CF
Species: Hu
Applications: BA
H00003059-M02
Species: Hu
Applications: ELISA, IHC, IHC-P, KD, PLA, S-ELISA, WB
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-12913
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-47842
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB

Publications for Cortactin Antibody (H00002017-M01)(1)


Showing Publication 1 - 1 of 1.
Publication using H00002017-M01 Applications Species
Halbert D, Domenyuk V, Spetzler D et al. Aptamers and uses thereof United States Patent Application US 9958448 B2 2018

Reviews for Cortactin Antibody (H00002017-M01) (0)

There are no reviews for Cortactin Antibody (H00002017-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cortactin Antibody (H00002017-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cortactin Products

Bioinformatics Tool for Cortactin Antibody (H00002017-M01)

Discover related pathways, diseases and genes to Cortactin Antibody (H00002017-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cortactin Antibody (H00002017-M01)

Discover more about diseases related to Cortactin Antibody (H00002017-M01).
 

Pathways for Cortactin Antibody (H00002017-M01)

View related products by pathway.

PTMs for Cortactin Antibody (H00002017-M01)

Learn more about PTMs related to Cortactin Antibody (H00002017-M01).
 

Research Areas for Cortactin Antibody (H00002017-M01)

Find related products by research area.

Blogs on Cortactin

There are no specific blogs for Cortactin, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cortactin Antibody (2B5) and receive a gift card or discount.

Bioinformatics

Gene Symbol CTTN
Entrez
Uniprot