CORO1B Recombinant Protein Antigen

Images

 
There are currently no images for CORO1B Recombinant Protein Antigen (NBP2-55203PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CORO1B Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CORO1B.

Source: E.coli

Amino Acid Sequence: AYVPSKQRDLKISRRNVLSDSRPAMAPGSSHLGAPASTTTAAGATPSGSLARAGEAGKLEEVMQELRALRALVKEQGDRICRLEEQLGRMENGD

Protein/Peptide Type
Recombinant Protein Antigen
Gene
CORO1B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-55203. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CORO1B Recombinant Protein Antigen

  • coronin, actin binding protein, 1B
  • coronin, actin-binding protein, 1B
  • coronin-1B
  • coronin-2
  • DKFZp762I166

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-58867
Species: Hu, Rt
Applications: WB, ICC/IF, IHC
NBP1-92304
Species: Hu
Applications: IHC, IHC-P
NBP2-15968
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-77417
Species: Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
NBP1-89102
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2987
Species: Hu
Applications: WB, ICC
MAB1904
Species: Hu
Applications: WB, IHC, ICC
NBP1-87346
Species: Hu
Applications: IHC, IHC-P
NB500-317
Species: Hu, Bv(-), Ca(-), Ch(-), Mu(-), Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, RIA
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Fe, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
AF1730
Species: Hu
Applications: Flow, AdBlk, CyTOF-ready, ICC
NBP1-86815
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NLS1522
Species: Hu, Mk, Pm
Applications: IHC, IHC-P, ICC
NBP1-00129
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF1444
Species: Mu
Applications: WB, IHC
NBP2-65721
Species: Hu
NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Single Cell Western
NBP2-54980
Species: Hu
Applications: WB, ICC/IF

Publications for CORO1B Recombinant Protein Antigen (NBP2-55203PEP) (0)

There are no publications for CORO1B Recombinant Protein Antigen (NBP2-55203PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CORO1B Recombinant Protein Antigen (NBP2-55203PEP) (0)

There are no reviews for CORO1B Recombinant Protein Antigen (NBP2-55203PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for CORO1B Recombinant Protein Antigen (NBP2-55203PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for CORO1B Recombinant Protein Antigen (NBP2-55203PEP)

Discover related pathways, diseases and genes to CORO1B Recombinant Protein Antigen (NBP2-55203PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CORO1B Recombinant Protein Antigen (NBP2-55203PEP)

Discover more about diseases related to CORO1B Recombinant Protein Antigen (NBP2-55203PEP).
 

Pathways for CORO1B Recombinant Protein Antigen (NBP2-55203PEP)

View related products by pathway.

PTMs for CORO1B Recombinant Protein Antigen (NBP2-55203PEP)

Learn more about PTMs related to CORO1B Recombinant Protein Antigen (NBP2-55203PEP).

Blogs on CORO1B

There are no specific blogs for CORO1B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CORO1B Antibody
NBP2-49634
CD11b Antibody
NB110-89474

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CORO1B Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CORO1B