COPS8 Antibody


Immunocytochemistry/ Immunofluorescence: COPS8 Antibody [NBP1-84407] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: COPS8 Antibody [NBP1-84407] - Staining of human cerebral cortex shows strong cytoplasmic positivity in astrocytes.

Product Details

Reactivity Hu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

COPS8 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:VGLPVEEAVKGILEQGWQADSTTRMVLPRKPVAGALDVSFNKFIPLSEPAP
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
COPS8 Protein (NBP1-84407PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for COPS8 Antibody

  • COP9 constitutive photomorphogenic homolog subunit 8 (Arabidopsis)
  • COP9 homolog
  • COP9 signalosome complex subunit 8
  • COP9
  • CSN8JAB1-containing signalosome subunit 8
  • hCOP9
  • MGC1297
  • SGN8MGC43256
  • Signalosome subunit 8


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Dr
Applications: WB, ICC/IF, IHC, IP
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu
Applications: WB, ELISA
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC-P, PLA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, IHC
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for COPS8 Antibody (NBP1-84407) (0)

There are no publications for COPS8 Antibody (NBP1-84407).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COPS8 Antibody (NBP1-84407) (0)

There are no reviews for COPS8 Antibody (NBP1-84407). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for COPS8 Antibody (NBP1-84407) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional COPS8 Products

Bioinformatics Tool for COPS8 Antibody (NBP1-84407)

Discover related pathways, diseases and genes to COPS8 Antibody (NBP1-84407). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COPS8 Antibody (NBP1-84407)

Discover more about diseases related to COPS8 Antibody (NBP1-84407).

Research Areas for COPS8 Antibody (NBP1-84407)

Find related products by research area.

Blogs on COPS8

There are no specific blogs for COPS8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our COPS8 Antibody and receive a gift card or discount.


Gene Symbol COPS8