COP9 signalosome complex subunit 2 Antibody (4B12)

Images

 
Western Blot: COP9 signalosome complex subunit 2 Antibody (4B12) [H00009318-M02] - COPS2 monoclonal antibody (M02), clone 4B12. Analysis of COPS2 expression in Hela S3 NE.
Immunocytochemistry/ Immunofluorescence: COP9 signalosome complex subunit 2 Antibody (4B12) [H00009318-M02] - Analysis of monoclonal antibody to COPS2 on HeLa cell . Antibody concentration 10 ug/ml.
Western Blot: COP9 signalosome complex subunit 2 Antibody (4B12) [H00009318-M02] - COPS2 monoclonal antibody (M02), clone 4B12. Analysis of COPS2 expression in PC-12.
Western Blot: COP9 signalosome complex subunit 2 Antibody (4B12) [H00009318-M02] - COPS2 monoclonal antibody (M02), clone 4B12. Analysis of COPS2 expression in Raw 264.7.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
4B12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

COP9 signalosome complex subunit 2 Antibody (4B12) Summary

Immunogen
COPS2 (NP_004227, 344 a.a. ~ 443 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. REHIEELLRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLELDHQKRGGARYTALDKWTNQLNSLNQAVVSKLA
Specificity
COPS2 - COP9 constitutive photomorphogenic homolog subunit 2 (Arabidopsis) (4B12)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
COPS2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for COP9 signalosome complex subunit 2 Antibody (4B12)

  • Alien homolog
  • ALIEN
  • COP9 constitutive photomorphogenic homolog subunit 2 (Arabidopsis)
  • COP9 signalosome complex subunit 2
  • CSN2JAB1-containing signalosome subunit 2
  • SGN2TR-interacting protein 15
  • Signalosome subunit 2
  • thyroid receptor interacting protein 15
  • Thyroid receptor-interacting protein 15
  • TRIP15TRIP-15

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010920-B01P
Species: Hu, Rt
Applications: ICC/IF, WB
NBP1-85436
Species: Hu
Applications: IHC, IHC-P
NBP2-80456
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-91150
Species: Hu
Applications: IHC, IHC-P
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-84307
Species: Hu
Applications: ICC/IF, WB
AF682
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, WB
NB120-495
Species: Dr, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB100-82245
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, Simple Western, WB
AF1759
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
NBP1-58268
Species: Hu, Mu
Applications: IHC, IHC-P, WB
H00008458-M06
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP1-85495
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-75458
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-P, IP, WB
NBP2-92907
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP1-71770
Species: Hu, Mu
Applications: ELISA, ICC/IF, IF, IHC, IHC-Fr, IHC-P, WB
NBP2-01863
Species: Hu, Mu
Applications: IHC, IHC-P, WB
255-SC/CF
Species: Hu
Applications: BA
H00009318-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF

Publications for COP9 signalosome complex subunit 2 Antibody (H00009318-M02) (0)

There are no publications for COP9 signalosome complex subunit 2 Antibody (H00009318-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COP9 signalosome complex subunit 2 Antibody (H00009318-M02) (0)

There are no reviews for COP9 signalosome complex subunit 2 Antibody (H00009318-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for COP9 signalosome complex subunit 2 Antibody (H00009318-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional COP9 signalosome complex subunit 2 Products

Bioinformatics Tool for COP9 signalosome complex subunit 2 Antibody (H00009318-M02)

Discover related pathways, diseases and genes to COP9 signalosome complex subunit 2 Antibody (H00009318-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COP9 signalosome complex subunit 2 Antibody (H00009318-M02)

Discover more about diseases related to COP9 signalosome complex subunit 2 Antibody (H00009318-M02).
 

Pathways for COP9 signalosome complex subunit 2 Antibody (H00009318-M02)

View related products by pathway.

PTMs for COP9 signalosome complex subunit 2 Antibody (H00009318-M02)

Learn more about PTMs related to COP9 signalosome complex subunit 2 Antibody (H00009318-M02).
 

Research Areas for COP9 signalosome complex subunit 2 Antibody (H00009318-M02)

Find related products by research area.

Blogs on COP9 signalosome complex subunit 2

There are no specific blogs for COP9 signalosome complex subunit 2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our COP9 signalosome complex subunit 2 Antibody (4B12) and receive a gift card or discount.

Bioinformatics

Gene Symbol COPS2
Entrez
Uniprot