COP1 Antibody - BSA Free

Western Blot: COP1 Antibody [NBP2-83979] - WB Suggested Anti-Rfwd2 Antibody. Titration: 1.0 ug/ml. Positive Control: Mouse Thymus

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

COP1 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of COP1. Peptide sequence: MSGLYSPVSEDSTVPQFEAPSPSHSSIIDSTEYSQPPGFSGTSQTKKQPW The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: COP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for COP1 Antibody - BSA Free

• Constitutive photomorphogenesis protein 1 homolog
• constitutive photomorphogenic protein (COP1)
• COP1RNF200FLJ10416
• E3 ubiquitin-protein ligase RFWD2
• EC 6.3.2.-
• hCOP1
• putative ubiquitin ligase COP1
• ring finger and WD repeat domain 2
• RING finger and WD repeat domain protein 2
• RING finger protein 200

Background

COP1 is an E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. It is directly involved in p53 ubiquitination and degradation, thereby abolishing p53-dependent transcription and apoptosis. It ubiquitinates p53 independently of MDM2 or RCHY1. It probably mediates E3 ubiquitin ligase activity by functioning as the essential RING domain subunit of larger E3 complexes. In contrast, it does not constitute the catalytic RING subunit in the DCX DET1-COP1 complex that negatively regulates JUN, where the ubiquitin ligase activity is mediated by RBX1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: COP1