COP1 Antibody (1E4) - Azide and BSA Free Summary
| Description |
Novus Biologicals Mouse COP1 Antibody (1E4) - Azide and BSA Free (H00064326-M01) is a monoclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
RFWD2 (NP_071902, 632 a.a. ~ 731 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. CLRSFKGHINEKNFVGLASNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAVCWRALPDGESNVLIAANSQGTIKVLELV |
| Specificity |
RFWD2 - ring finger and WD repeat domain 2 |
| Isotype |
IgG2b Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
COP1 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA 1:100-1:2000
- Immunocytochemistry/ Immunofluorescence 1:10-1:500
- Sandwich ELISA
- Western Blot 1:500
|
| Application Notes |
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for COP1 Antibody (1E4) - Azide and BSA Free
Background
COP1 is an E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. It is directly involved in p53 ubiquitination and degradation, thereby abolishing p53-dependent transcription and apoptosis. It ubiquitinates p53 independently of MDM2 or RCHY1. It probably mediates E3 ubiquitin ligase activity by functioning as the essential RING domain subunit of larger E3 complexes. In contrast, it does not constitute the catalytic RING subunit in the DCX DET1-COP1 complex that negatively regulates JUN, where the ubiquitin ligase activity is mediated by RBX1.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
Publications for COP1 Antibody (H00064326-M01) (0)
There are no publications for COP1 Antibody (H00064326-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for COP1 Antibody (H00064326-M01) (0)
There are no reviews for COP1 Antibody (H00064326-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for COP1 Antibody (H00064326-M01). (Showing 1 - 1 of 1 FAQ).
-
Could you let us know whether this antibody has been mentioned in a publication so that we can look at those images? Moreover, could you please tell us whether the immunoblot presented on you website shows the labeling of the endogenous RFWD2 from 3T3 cells or whether a lysate of cells transfected with an RFWD2 expression vector has been used for blotting?
- This product has not yet been mentioned in any publications that we are aware of. And in regards to the WB image, this image was generated with 3T3 cells showing the staining of endogenous COP1 / RFWD2.
Secondary Antibodies
| |
Isotype Controls
|
Additional COP1 Products
Research Areas for COP1 Antibody (H00064326-M01)
Find related products by research area.
|
Blogs on COP1