Connexin 40/GJA5 Antibody - BSA Free Summary
| Description |
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen |
Synthetic peptides corresponding to GJA5 (gap junction protein, alpha 5, 40kDa) The peptide sequence was selected from the N terminal of GJA5.
Peptide sequence STPSLVYMGHAMHTVRMQEKRKLREAERAKEVRGSGSYEYPVAEKAELSC. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
GJA5 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for Connexin 40/GJA5 Antibody - BSA Free
Background
GJA5 belongs to the connexin family, alpha-type subfamily. It is an integral membrane protein that forms transmembrane channels, and may function in small molecule transport, muscle contraction and cell-cell communication. Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been identified.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, WB
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, KD, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Fi, Hu, Pm, Mu
Applications: ELISA, ICC/IF, KD, WB
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rb, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, MiAr, WB
Species: Hu
Applications: WB
Publications for Connexin 40/GJA5 Antibody (NBP1-59204) (0)
There are no publications for Connexin 40/GJA5 Antibody (NBP1-59204).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Connexin 40/GJA5 Antibody (NBP1-59204) (0)
There are no reviews for Connexin 40/GJA5 Antibody (NBP1-59204).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Connexin 40/GJA5 Antibody (NBP1-59204) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Connexin 40/GJA5 Products
Research Areas for Connexin 40/GJA5 Antibody (NBP1-59204)
Find related products by research area.
|
Blogs on Connexin 40/GJA5