Connexin 37/GJA4 Antibody

Images

 
Immunohistochemistry: Connexin 37/GJA4 Antibody [NBP2-48886] - Staining of human heart muscle shows moderate membranous and cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Connexin 37/GJA4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: AKDPQVERALAAVERQMAKISVAEDGRLRIRGALMGTYVASVLCKSVLEAGFLYGQWRLYGWTMEPVFVCQRAPCPYLVDCFVSR
Predicted Species
Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GJA4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Connexin 37/GJA4 Recombinant Protein Antigen (NBP2-48886PEP)
Reviewed Applications
Read 1 Review rated 1
using
NBP2-48886 in the following applications:

Reactivity Notes

Mouse (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Connexin 37/GJA4 Antibody

  • Connexin 37
  • Connexin-37
  • CX37
  • CX37connexin-37
  • gap junction alpha-4 protein
  • gap junction protein, alpha 4, 37kD (connexin 37)
  • gap junction protein, alpha 4, 37kDa (connexin 37)
  • gap junction protein, alpha 4, 37kDa
  • GJA4

Background

FUNCTION: One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. SUBUNIT: A connexon is composed of a hexamer of connexins. SUBCELLULAR LOCATION: Membrane; multi-pass membrane protein. TISSUE SPECIFICITY: Highly expressed in lung. SIMILARITY: Belongs to the connexin family. Alpha-type (group II) subfamily.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-53381
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, WB
NBP2-41304
Species: Hu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-59197
Species: Hu
Applications: WB
NBP1-59254
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-68799
Species: Hu
Applications: IHC, IHC-P
NB300-500
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr, IHC-P, WB
AF4090
Species: Hu
Applications: IHC, IP, Neut, WB
NBP1-84333
Species: Hu
Applications: IHC, IHC-P, WB
DMP300
Species: Hu
Applications: ELISA
NBP2-61141
Species: Hu
Applications: ICC/IF, IHC
NBP3-17078
Species: Hu
Applications: IHC, IHC-P
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB
DSE100
Species: Hu
Applications: ELISA
H00002707-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB

Publications for Connexin 37/GJA4 Antibody (NBP2-48886) (0)

There are no publications for Connexin 37/GJA4 Antibody (NBP2-48886).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for Connexin 37/GJA4 Antibody (NBP2-48886) (1) 11

Average Rating: 1
(Based on 1 review)
We have 1 review tested in 1 species: Rat.

Reviews using NBP2-48886:
Filter by Applications
IHC-Fr
(1)
All Applications
Filter by Species
Rat
(1)
All Species
Images Ratings Applications Species Date Details
  1
reviewed by:
Verified Customer
IHC-Fr Rat 06/27/2022
View

Summary

ApplicationImmunohistochemistry-Frozen
Sample TestedAdult heart
SpeciesRat
LotR45142

Comments

Comments***Novus Innovators Program - new species or application used on a primary antibody.***

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Connexin 37/GJA4 Antibody (NBP2-48886) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Connexin 37/GJA4 Products

Bioinformatics Tool for Connexin 37/GJA4 Antibody (NBP2-48886)

Discover related pathways, diseases and genes to Connexin 37/GJA4 Antibody (NBP2-48886). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Connexin 37/GJA4 Antibody (NBP2-48886)

Discover more about diseases related to Connexin 37/GJA4 Antibody (NBP2-48886).
 

Pathways for Connexin 37/GJA4 Antibody (NBP2-48886)

View related products by pathway.

PTMs for Connexin 37/GJA4 Antibody (NBP2-48886)

Learn more about PTMs related to Connexin 37/GJA4 Antibody (NBP2-48886).
 

Research Areas for Connexin 37/GJA4 Antibody (NBP2-48886)

Find related products by research area.

Blogs on Connexin 37/GJA4

There are no specific blogs for Connexin 37/GJA4, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

1
5
0
4
0
3
0
2
0
1
1

Verified Customer
06/27/2022
Application: IHC-Fr
Species: Rat

Bioinformatics

Gene Symbol GJA4