Connexin 30.1/GJB5 Antibody

Images

 
Western Blot: Connexin 30.1/GJB5 Antibody [NBP1-84333] - Analysis in control (vector only transfected HEK293T lysate) and GJB5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian ...read more
Immunohistochemistry-Paraffin: Connexin 30.1/GJB5 Antibody [NBP1-84333] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Connexin 30.1/GJB5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KRCHECLAARKAQAMCTGHHPHGTTSSCKQDDLLSGDLIFLGSDSHPPLLPDRPRDHVKK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GJB5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Connexin 30.1/GJB5 Protein (NBP1-84333PEP)
Publications
Read Publication using NBP1-84333.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Connexin 30.1/GJB5 Antibody

  • Connexin 30.1
  • connexin 31.1
  • connexin-31.1
  • CX31.1
  • CX31.1gap junction beta-5 protein
  • gap junction protein, beta 5 (connexin 31.1)
  • gap junction protein, beta 5
  • gap junction protein, beta 5, 31.1kDa
  • GJB5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-41304
Species: Hu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP3-17078
Species: Hu
Applications: ELISA, ICC/IF, IF, IHC, IHC-P, WB
H00002707-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-53381
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, WB
NBP2-76925
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-59254
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-59197
Species: Hu
Applications: WB
NBP2-68799
Species: Hu
Applications: IHC, IHC-P
NBP2-61141
Species: Hu
Applications: ICC/IF, IHC
NBP1-59263
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-88040
Species: Hu
Applications: IHC, IHC-P, WB
NB100-1519
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-FrFl, PEP-ELISA, WB
NBP3-17923
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-84247
Species: Hu
Applications: WB
NBP1-31806
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB7619
Species: Hu
Applications: ICC, IHC, Simple Western, WB

Publications for Connexin 30.1/GJB5 Antibody (NBP1-84333)(1)

We have publications tested in 1 confirmed species: Human.


Filter By Application
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Connexin 30.1/GJB5 Antibody (NBP1-84333) (0)

There are no reviews for Connexin 30.1/GJB5 Antibody (NBP1-84333). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Connexin 30.1/GJB5 Antibody (NBP1-84333) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Connexin 30.1/GJB5 Products

Bioinformatics Tool for Connexin 30.1/GJB5 Antibody (NBP1-84333)

Discover related pathways, diseases and genes to Connexin 30.1/GJB5 Antibody (NBP1-84333). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Connexin 30.1/GJB5 Antibody (NBP1-84333)

Discover more about diseases related to Connexin 30.1/GJB5 Antibody (NBP1-84333).
 

Pathways for Connexin 30.1/GJB5 Antibody (NBP1-84333)

View related products by pathway.

Research Areas for Connexin 30.1/GJB5 Antibody (NBP1-84333)

Find related products by research area.

Blogs on Connexin 30.1/GJB5

There are no specific blogs for Connexin 30.1/GJB5, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Connexin 30.1/GJB5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GJB5