Complement Factor H Antibody

Images

 
Western Blot: Complement Factor H Antibody [H00003075-D01P] - Analysis of CFH expression in human kidney.
Western Blot: Complement Factor H Antibody [H00003075-D01P] - Analysis of CFH expression in transfected 293T cell line by CFH polyclonal antibody.Lane 1: CFH transfected lysate(51.00 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Complement Factor H Antibody Summary

Immunogen
CFH (NP_001014975.1, 1 a.a. - 449 a.a.) full-length human protein. MRLLAKIICLMLWAICVAEDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNHGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVSFTL
Specificity
Reacts with complement factor H.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CFH
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against tissue and transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Complement Factor H Antibody

  • adrenomedullin binding protein
  • age-related maculopathy susceptibility 1
  • AHUS1
  • AMBP1
  • ARMD4
  • ARMS1
  • beta-1H
  • beta-1-H-globulin
  • beta-1-H-globulin
  • CFH
  • CFHL3
  • Complement Factor H
  • factor H
  • factor H-like 1
  • FH
  • FHL1
  • H factor 1 (complement)
  • H factor 1
  • H factor 2 (complement)
  • HF
  • HF1
  • HF1ARMS1
  • HF2
  • HUS
  • HUSMGC88246

Background

This gene is a member of the Regulator of Complement Activation (RCA) gene cluster and encodes a protein with twenty short concensus repeat (SCR) domains. This protein is secreted into the bloodstream and has an essential role in the regulation of complement activation, restricting this innate defense mechanism to microbial infections. Mutations in this gene have been associated with hemolytic-uremic syndrome (HUS) and chronic hypocomplementemic nephropathy. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-05027
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, PEP-ELISA, S-ELISA
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-89985
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
MAB2005
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF2009
Species: Hu
Applications: WB, IHC
MAB3307
Species: Hu
Applications: WB, IP
AF1936
Species: Hu
Applications: WB, IP
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
MAB4247
Species: Hu
Applications: WB, IP
AF4245
Species: Hu
Applications: WB, IP
NBP1-07010
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00003075-D01P
Species: Hu
Applications: WB

Publications for Complement Factor H Antibody (H00003075-D01P) (0)

There are no publications for Complement Factor H Antibody (H00003075-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Complement Factor H Antibody (H00003075-D01P) (0)

There are no reviews for Complement Factor H Antibody (H00003075-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Complement Factor H Antibody (H00003075-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Complement Factor H Products

Bioinformatics Tool for Complement Factor H Antibody (H00003075-D01P)

Discover related pathways, diseases and genes to Complement Factor H Antibody (H00003075-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Complement Factor H Antibody (H00003075-D01P)

Discover more about diseases related to Complement Factor H Antibody (H00003075-D01P).
 

Pathways for Complement Factor H Antibody (H00003075-D01P)

View related products by pathway.

PTMs for Complement Factor H Antibody (H00003075-D01P)

Learn more about PTMs related to Complement Factor H Antibody (H00003075-D01P).

Blogs on Complement Factor H

There are no specific blogs for Complement Factor H, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Complement Factor H Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CFH
Entrez
Uniprot