Complement Component C2 Antibody (2C11)

Images

 
There are currently no images for Complement Component C2 Antibody (H00000717-M15).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
2C11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Complement Component C2 Antibody (2C11) Summary

Immunogen
C2 (NP_000054.2, 21 a.a. - 243 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. APSCPQNVNISGGTFTLSHGWAPGSLLTYSCPQGLYPSPASRLCKSSGQWQTPGATRSLSKAVCKPVRCPAPVSFENGIYTPRLGSYPVGGNVSFECEDGFILRGSPVRQCRPNGMWDGETAVCDNGAGHCPNPGISLGAVRTGFRFGHGDKVRYRCSSNLVLTGSSERECQGNGVWSGTEPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKESLGR
Specificity
This product is specific for Human C2 monoclonal antibody (M15), clone 2C11 [Gene ID: 717].
Isotype
IgG2a Lambda
Clonality
Monoclonal
Host
Mouse
Gene
C2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Complement Component C2 Antibody (2C11)

  • C2
  • C3/C5 convertase
  • CO2
  • complement C2
  • complement component 2
  • Complement Component C2
  • DKFZp779M0311
  • EC 3.4.21
  • EC 3.4.21.43

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88526
Species: Hu
Applications: WB, IHC, IHC-P
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NBP2-46723
Species: Hu
Applications: IHC, IHC-P
NBP1-89985
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-79075
Species: Hu
Applications: IHC, IHC-Fr, IHC-P
NBP2-30078
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
H00005688-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP2-33688
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88119
Species: Hu
Applications: IHC, IHC-P
H00000717-M15
Species: Hu
Applications: ELISA

Publications for Complement Component C2 Antibody (H00000717-M15) (0)

There are no publications for Complement Component C2 Antibody (H00000717-M15).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Complement Component C2 Antibody (H00000717-M15) (0)

There are no reviews for Complement Component C2 Antibody (H00000717-M15). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Complement Component C2 Antibody (H00000717-M15) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Complement Component C2 Antibody (2C11) Products

Related Products by Gene

Bioinformatics Tool for Complement Component C2 Antibody (H00000717-M15)

Discover related pathways, diseases and genes to Complement Component C2 Antibody (H00000717-M15). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Complement Component C2 Antibody (H00000717-M15)

Discover more about diseases related to Complement Component C2 Antibody (H00000717-M15).
 

Pathways for Complement Component C2 Antibody (H00000717-M15)

View related products by pathway.

PTMs for Complement Component C2 Antibody (H00000717-M15)

Learn more about PTMs related to Complement Component C2 Antibody (H00000717-M15).

Blogs on Complement Component C2

There are no specific blogs for Complement Component C2, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our Complement Component C2 Antibody (2C11) and receive a gift card or discount.

Bioinformatics

Gene Symbol C2
Entrez
Uniprot

Customers Who Bought This Also Bought