Complement Component C1rLP Antibody


Western Blot: Complement Component C1rLP Antibody [NBP1-88314] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma more
Immunocytochemistry/ Immunofluorescence: Complement Component C1rLP Antibody [NBP1-88314] - Immunofluorescent staining of human cell line U-2 OS shows localization to microtubules.
Immunohistochemistry-Paraffin: Complement Component C1rLP Antibody [NBP1-88314] - Staining of human kidney shows positivity in plasma.
Immunohistochemistry-Paraffin: Complement Component C1rLP Antibody [NBP1-88314] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

Complement Component C1rLP Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: NVLPVCLPDNETLYRSGLLGYVSGFGMEMGWLTTELKYSRLPVAPREACNAWLQKRQRPEVFSDNMFCVGDETQ
Specificity of human Complement Component C1rLP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Complement Component C1rLP Recombinant Protein Antigen (NBP1-88314PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (81%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Complement Component C1rLP Antibody

  • C1RL
  • C1RL1
  • C1RL1complement C1r subcomponent-like protein
  • C1r-like protein
  • C1r-like serine protease analog protein
  • C1r-LPcomplement C1r-like proteinase
  • C1RLPEC 3.4.21.-
  • CLSPa
  • complement component 1, r subcomponent-like
  • Complement Component C1rLP
  • EC 3.4.21
  • EC


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IP
Species: Hu
Applications: WB, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: Flow, ICC/IF, IHC, IP
Species: Hu
Species: Hu
Applications: ICC/IF
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Complement Component C1rLP Antibody (NBP1-88314) (0)

There are no publications for Complement Component C1rLP Antibody (NBP1-88314).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Complement Component C1rLP Antibody (NBP1-88314) (0)

There are no reviews for Complement Component C1rLP Antibody (NBP1-88314). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Complement Component C1rLP Antibody (NBP1-88314) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Complement Component C1rLP Products

Bioinformatics Tool for Complement Component C1rLP Antibody (NBP1-88314)

Discover related pathways, diseases and genes to Complement Component C1rLP Antibody (NBP1-88314). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Complement Component C1rLP Antibody (NBP1-88314)

Discover more about diseases related to Complement Component C1rLP Antibody (NBP1-88314).

PTMs for Complement Component C1rLP Antibody (NBP1-88314)

Learn more about PTMs related to Complement Component C1rLP Antibody (NBP1-88314).

Blogs on Complement Component C1rLP

There are no specific blogs for Complement Component C1rLP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Complement Component C1rLP Antibody and receive a gift card or discount.


Gene Symbol C1RL