Complement Component C1rLP Antibody

Western Blot: Complement Component C1rLP Antibody [NBP1-88314] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue

Immunocytochemistry/Immunofluorescence: Complement Component C1rLP Antibody [NBP1-88314] - Immunofluorescent staining of human cell line U-2 OS shows localization to microtubules.

Immunohistochemistry-Paraffin: Complement Component C1rLP Antibody [NBP1-88314] - Staining of human kidney shows positivity in plasma.

Immunohistochemistry-Paraffin: Complement Component C1rLP Antibody [NBP1-88314] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Complement Component C1rLP Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NVLPVCLPDNETLYRSGLLGYVSGFGMEMGWLTTELKYSRLPVAPREACNAWLQKRQRPEVFSDNMFCVGDETQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: C1RL
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Complement Component C1rLP Recombinant Protein Antigen (NBP1-88314PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (81%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Complement Component C1rLP Antibody

• C1RL
• C1RL1
• C1RL1complement C1r subcomponent-like protein
• C1r-like protein
• C1r-like serine protease analog protein
• C1r-LPcomplement C1r-like proteinase
• C1RLPEC 3.4.21.-
• CLSPa
• complement component 1, r subcomponent-like
• Complement Component C1rLP
• EC 3.4.21
• EC 3.4.21.41

Background

C1RL mediates the proteolytic cleavage of HP/haptoglobin in the endoplasmic reticulum

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: C1RL