Recombinant Human Complement C4b Protein

Images

 
There are currently no images for Complement C4b Partial Recombinant Protein (H00000721-Q02).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Complement C4b Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-100 of Human C4B partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:VRSFFPENWLWRVETVDRFQILTLWLPDSLTTWEIHGLSLSKTKGLCVATPVQLRVFREFHLHLRLPMSVRRFEQLELRPVLYNYLDKNLTVSVHVSPVE

Protein/Peptide Type
Partial Recombinant Protein
Gene
C4B

Applications/Dilutions

Application Notes
Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Complement C4b Protein

  • basic C4
  • Basic complement C4
  • C3 and PZP-like alpha-2-macroglobulin domain-containing protein 3
  • C4B1
  • C4B12
  • C4B2
  • C4B3
  • C4FMGC164979
  • CH
  • Chido form of C4
  • CO4C4B5
  • complement C4-B
  • complement C4B1a
  • complement component 4B (Chido blood group)
  • complement component 4B
  • CPAMD3FLJ60561
  • EC 2.1.1.144
  • EC 2.7.11

Background

C4B - complement component 4B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34234
Species: Hu
Applications: ICC/IF, IHC-Fr, IHC-P
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-89985
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
AF1936
Species: Hu
Applications: WB, IP
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB1233
Species: Hu
Applications: Flow, IP, CyTOF-ready, ICC
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
AF4779
Species: Hu
Applications: WB, IHC
NBP1-87581
Species: Hu
Applications: IHC, IHC-P
AF2009
Species: Hu
Applications: WB, IHC
NBP2-12553
Species: Hu
NBP2-13893
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-29460
Species: Hu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PAGE
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP1-88263
Species: Hu
Applications: WB, IHC, IHC-P
H00000721-Q02
Species: Hu
Applications: WB, ELISA, PA

Publications for Complement C4b Partial Recombinant Protein (H00000721-Q02) (0)

There are no publications for Complement C4b Partial Recombinant Protein (H00000721-Q02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Complement C4b Partial Recombinant Protein (H00000721-Q02) (0)

There are no reviews for Complement C4b Partial Recombinant Protein (H00000721-Q02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Complement C4b Partial Recombinant Protein (H00000721-Q02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Complement C4b Products

Bioinformatics Tool for Complement C4b Partial Recombinant Protein (H00000721-Q02)

Discover related pathways, diseases and genes to Complement C4b Partial Recombinant Protein (H00000721-Q02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Complement C4b Partial Recombinant Protein (H00000721-Q02)

Discover more about diseases related to Complement C4b Partial Recombinant Protein (H00000721-Q02).
 

Pathways for Complement C4b Partial Recombinant Protein (H00000721-Q02)

View related products by pathway.

PTMs for Complement C4b Partial Recombinant Protein (H00000721-Q02)

Learn more about PTMs related to Complement C4b Partial Recombinant Protein (H00000721-Q02).

Blogs on Complement C4b

There are no specific blogs for Complement C4b, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Albumin Antibody
NB600-41532

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Complement C4b Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol C4B