Common gamma Chain/IL-2 R gamma Antibody Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENPFLFAL |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
IL2RG |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Common gamma Chain/IL-2 R gamma Antibody
Background
The interleukin 2 (IL2) receptor gamma chain (IL2RG), an important signalling component of many interleukin receptors(IL2,IL4,IL7,IL9, and IL15), is thus referred to as the common gamma chain. Mutations in this X-chromosome-linked genecause X-linked severe combined immunodeficiency (XSCID). (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ChIP, Simple Western, WB
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, Neut, WB
Species: Hu, Mu
Applications: CyTOF-ready, ICC, IP, ICFlow, KO, Simple Western, WB
Species: Mu
Applications: BA
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
Species: Hu, Mu, Rt
Applications: Simple Western, WB
Species: Rt
Applications: IHC, WB
Species: Mu
Applications: ELISA
Publications for Common gamma Chain/IL-2 R gamma Antibody (NBP2-56084) (0)
There are no publications for Common gamma Chain/IL-2 R gamma Antibody (NBP2-56084).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Common gamma Chain/IL-2 R gamma Antibody (NBP2-56084) (0)
There are no reviews for Common gamma Chain/IL-2 R gamma Antibody (NBP2-56084).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Common gamma Chain/IL-2 R gamma Antibody (NBP2-56084) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Common gamma Chain/IL-2 R gamma Products
Research Areas for Common gamma Chain/IL-2 R gamma Antibody (NBP2-56084)
Find related products by research area.
|
Blogs on Common gamma Chain/IL-2 R gamma