Common gamma Chain/IL-2 R gamma Antibody


Immunocytochemistry/ Immunofluorescence: Common gamma Chain/IL-2 R gamma Antibody [NBP2-56084] - Staining of human cell line HaCaT shows localization to vesicles.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF

Order Details

Common gamma Chain/IL-2 R gamma Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENPFLFAL
Specificity of human Common gamma Chain/IL-2 R gamma antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Common gamma Chain/IL-2 R gamma Recombinant Protein Antigen (NBP2-56084PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for Common gamma Chain/IL-2 R gamma Antibody

  • CD132 antigen
  • CD132
  • CIDX
  • combined immunodeficiency, X-linked
  • common cytokine receptor gamma chain
  • Common gamma Chain
  • common gamma-chain
  • cytokine receptor common subunit gamma
  • gamma(c)
  • IL-2 R gamma
  • IL-2 receptor subunit gamma
  • IL2R gamma
  • IL-2R subunit gamma
  • IL2RG
  • IL-2RG
  • IMD4
  • interleukin 2 receptor, gamma
  • Interleukin-2 receptor subunit gamma
  • P64
  • SCIDX1
  • severe combined immunodeficiency


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, IP, CyTOF-ready, ICC, ICFlow, KO
Species: Mu
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
Species: Hu, Mu, Rt
Applications: WB, IHC, CyTOF-ready, ICC, ICFlow
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for Common gamma Chain/IL-2 R gamma Antibody (NBP2-56084) (0)

There are no publications for Common gamma Chain/IL-2 R gamma Antibody (NBP2-56084).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Common gamma Chain/IL-2 R gamma Antibody (NBP2-56084) (0)

There are no reviews for Common gamma Chain/IL-2 R gamma Antibody (NBP2-56084). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Common gamma Chain/IL-2 R gamma Antibody (NBP2-56084) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional Common gamma Chain/IL-2 R gamma Products

Bioinformatics Tool for Common gamma Chain/IL-2 R gamma Antibody (NBP2-56084)

Discover related pathways, diseases and genes to Common gamma Chain/IL-2 R gamma Antibody (NBP2-56084). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Common gamma Chain/IL-2 R gamma Antibody (NBP2-56084)

Discover more about diseases related to Common gamma Chain/IL-2 R gamma Antibody (NBP2-56084).

Pathways for Common gamma Chain/IL-2 R gamma Antibody (NBP2-56084)

View related products by pathway.

PTMs for Common gamma Chain/IL-2 R gamma Antibody (NBP2-56084)

Learn more about PTMs related to Common gamma Chain/IL-2 R gamma Antibody (NBP2-56084).

Research Areas for Common gamma Chain/IL-2 R gamma Antibody (NBP2-56084)

Find related products by research area.

Blogs on Common gamma Chain/IL-2 R gamma

There are no specific blogs for Common gamma Chain/IL-2 R gamma, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Common gamma Chain/IL-2 R gamma Antibody and receive a gift card or discount.


Gene Symbol IL2RG