Common gamma Chain/IL-2 R gamma Antibody

Western Blot: Common gamma Chain/IL-2 R gamma Antibody [NBP2-14122] - Analysis in human cell line U-937 MG.

Immunohistochemistry-Paraffin: Common gamma Chain/IL-2 R gamma Antibody [NBP2-14122] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: Common gamma Chain/IL-2 R gamma Antibody [NBP2-14122] - Staining of human appendix shows high expression.

Immunohistochemistry-Paraffin: Common gamma Chain/IL-2 R gamma Antibody [NBP2-14122] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: Common gamma Chain/IL-2 R gamma Antibody [NBP2-14122] - Staining in human appendix and pancreas tissues using anti-IL2RG antibody. Corresponding IL2RG RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Common gamma Chain/IL-2 R gamma Antibody [NBP2-14122] - Staining of human gastrointestinal shows strong cytoplasmic positivity in cells in lamina propria.

Product Discontinued

Common gamma Chain/IL-2 R gamma Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNC TWNSSSEPQPTNLTLHYWYKNSDNDK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IL2RG
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Common gamma Chain/IL-2 R gamma Antibody

• CD132 antigen
• CD132
• CIDX
• combined immunodeficiency, X-linked
• common cytokine receptor gamma chain
• Common gamma Chain
• common gamma-chain
• cytokine receptor common subunit gamma
• gamma(c)
• IL-2 R gamma
• IL-2 receptor subunit gamma
• IL2R gamma
• IL-2R subunit gamma
• IL2RG
• IL-2RG
• IMD4
• interleukin 2 receptor, gamma
• Interleukin-2 receptor subunit gamma
• P64
• SCIDX
• SCIDX1
• severe combined immunodeficiency

Background

The interleukin 2 (IL2) receptor gamma chain (IL2RG), an important signalling component of many interleukin receptors(IL2,IL4,IL7,IL9, and IL15), is thus referred to as the common gamma chain. Mutations in this X-chromosome-linked genecause X-linked severe combined immunodeficiency (XSCID). (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IL2RG