We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Common gamma Chain/IL-2 R gamma Antibody

Images

 
Western Blot: Common gamma Chain/IL-2 R gamma Antibody [NBP2-14122] - Analysis in human cell line U-937 MG.
Immunohistochemistry-Paraffin: Common gamma Chain/IL-2 R gamma Antibody [NBP2-14122] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Common gamma Chain/IL-2 R gamma Antibody [NBP2-14122] - Staining of human appendix shows high expression.
Immunohistochemistry-Paraffin: Common gamma Chain/IL-2 R gamma Antibody [NBP2-14122] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: Common gamma Chain/IL-2 R gamma Antibody [NBP2-14122] - Staining in human appendix and pancreas tissues using anti-IL2RG antibody. Corresponding IL2RG RNA-seq data are presented for the ...read more
Immunohistochemistry-Paraffin: Common gamma Chain/IL-2 R gamma Antibody [NBP2-14122] - Staining of human gastrointestinal shows strong cytoplasmic positivity in cells in lamina propria.

Order Details


    • Catalog Number
      NBP2-14122
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Common gamma Chain/IL-2 R gamma Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNC TWNSSSEPQPTNLTLHYWYKNSDNDK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IL2RG
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Common gamma Chain/IL-2 R gamma Antibody

  • CD132 antigen
  • CD132
  • CIDX
  • combined immunodeficiency, X-linked
  • common cytokine receptor gamma chain
  • Common gamma Chain
  • common gamma-chain
  • cytokine receptor common subunit gamma
  • gamma(c)
  • IL-2 R gamma
  • IL-2 receptor subunit gamma
  • IL2R gamma
  • IL-2R subunit gamma
  • IL2RG
  • IL-2RG
  • IMD4
  • interleukin 2 receptor, gamma
  • Interleukin-2 receptor subunit gamma
  • P64
  • SCIDX
  • SCIDX1
  • severe combined immunodeficiency

Background

The interleukin 2 (IL2) receptor gamma chain (IL2RG), an important signalling component of many interleukin receptors(IL2,IL4,IL7,IL9, and IL15), is thus referred to as the common gamma chain. Mutations in this X-chromosome-linked genecause X-linked severe combined immunodeficiency (XSCID). (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

202-IL
Species: Hu
Applications: BA
207-IL
Species: Hu
Applications: BA
247-ILB
Species: Hu
Applications: BA
6507-IL/CF
Species: Hu
Applications: BA
NBP2-37737
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, WB
NBP1-90044
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-43666
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF2168
Species: Hu, Mu
Applications: ChIP, Simple Western, WB
AF594
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, Neut, WB
AF1584
Species: Hu, Mu
Applications: CyTOF-ready, ICC, IP, ICFlow, KO, Simple Western, WB
409-ML
Species: Mu
Applications: BA
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
DR2A00
Species: Hu
Applications: ELISA
NBP1-49045
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
MAB224
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
NBP2-75547
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
AF4117
Species: Rt
Applications: IHC, WB
DY413
Species: Mu
Applications: ELISA

Publications for Common gamma Chain/IL-2 R gamma Antibody (NBP2-14122) (0)

There are no publications for Common gamma Chain/IL-2 R gamma Antibody (NBP2-14122).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Common gamma Chain/IL-2 R gamma Antibody (NBP2-14122) (0)

There are no reviews for Common gamma Chain/IL-2 R gamma Antibody (NBP2-14122). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Common gamma Chain/IL-2 R gamma Antibody (NBP2-14122) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Common gamma Chain/IL-2 R gamma Products

Research Areas for Common gamma Chain/IL-2 R gamma Antibody (NBP2-14122)

Find related products by research area.

Blogs on Common gamma Chain/IL-2 R gamma

There are no specific blogs for Common gamma Chain/IL-2 R gamma, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Common gamma Chain/IL-2 R gamma Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IL2RG