Collagen XVII Recombinant Protein Antigen

Images

 
There are currently no images for Collagen XVII Recombinant Protein Antigen (NBP2-38686PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Collagen XVII Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human COL17A1.

Source: E. coli

Amino Acid Sequence: NLPSHVWSSTLPAGSSMGTYHNNMTTQSSSLLNTNAYSAGSVFGVPNNMASCSPTLHPGLSTSSSVFGMQNNLAPSLTTLSHGTTTTSTA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
COL17A1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38686.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Collagen XVII Recombinant Protein Antigen

  • 180 kDa bullous pemphigoid antigen 2
  • BA16H23.2
  • BP180
  • BP180alpha 1 type XVII collagen
  • BPA-2
  • BPAG2
  • BPAG2bA16H23.2 (collagen, type XVII, alpha 1 (BP180))
  • bullous pemphigoid antigen 2 (180kD)
  • Bullous pemphigoid antigen 2
  • COL17A1
  • Collagen 17
  • collagen alpha-1(XVII) chain
  • Collagen XVII
  • collagen XVII, alpha-1 polypeptide
  • collagen, type XVII, alpha 1
  • Collagen-17
  • ERED
  • FLJ60881
  • KIAA0204
  • LAD-1

Background

Collagen XVII encodes the alpha chain of type XVII collagen. Unlike most collagens, collagen XVII is a transmembrane protein. Collagen XVII is a structural component of hemidesmosomes, multiprotein complexes at the dermal-epidermal basement membrane zone that mediate adhesion of keratinocytes to the underlying membrane. Mutations in this gene are associated with both generalized atrophic benign and junctional epidermolysis bullosa. Two homotrimeric forms of type XVII collagen exist. The full length form is the transmembrane protein. A soluble form, referred to as either ectodomain or LAD-1, is generated by proteolytic processing of the full length form. [provided by RefSeq]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89946
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84020
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1730
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
NB200-540
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-78984
Species: Hu, Mu
Applications: DB, ICC/IF, IHC, IHC-P, IP, WB
AF944
Species: Hu
Applications: IHC, WB
NBP1-86126
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
7268-CT
Species: Hu
Applications: BA
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
NB100-56340
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
NBP2-46622
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF629
Species: Hu
Applications: CyTOF-ready, Flow, InhibCellGro, WB
DY4517-05
Species: Mu
Applications: ELISA
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP2-70411
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP3-15642
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-38686PEP
Species: Hu
Applications: AC

Publications for Collagen XVII Recombinant Protein Antigen (NBP2-38686PEP) (0)

There are no publications for Collagen XVII Recombinant Protein Antigen (NBP2-38686PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Collagen XVII Recombinant Protein Antigen (NBP2-38686PEP) (0)

There are no reviews for Collagen XVII Recombinant Protein Antigen (NBP2-38686PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Collagen XVII Recombinant Protein Antigen (NBP2-38686PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Collagen XVII Products

Research Areas for Collagen XVII Recombinant Protein Antigen (NBP2-38686PEP)

Find related products by research area.

Blogs on Collagen XVII

There are no specific blogs for Collagen XVII, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Collagen XVII Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol COL17A1