Collagen XII alpha1 Antibody

Immunocytochemistry/Immunofluorescence: Collagen XII alpha1 Antibody [NBP2-57420] - Staining of human cell line SiHa shows localization to nucleoplasm. Antibody staining is shown in green.

Product Discontinued

Collagen XII alpha1 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TGYKVILTPMTAGSRQHALSVGPQTTTLSVRDLSADTEYQISVSAMKGMTSSEPISIMEKTQPMKVQVECSR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: COL12A1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Mouse 86%, Rat 88%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Collagen XII alpha1 Antibody

• BA209D8.1
• COL12A1L
• collagen alpha-1(XII) chain
• collagen type XII proteoglycan
• collagen, type XII, alpha 1
• DJ234P15.1
• type XII, alpha 1-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Collagen XII alpha1 Antibody (NBP2-57420)(1)

Publication using NBP2-57420

• Dobson LK, Zeitouni S, McNeill EP Et al. Canine Mesenchymal Stromal Cell-Mediated Bone Regeneration is Enhanced in the Presence of Sub-Therapeutic Concentrations of BMP-2 in a Murine Calvarial Defect Model Frontiers in bioengineering and biotechnology 2021-11-02 [PMID: 34796168] (IF/IHC, Mouse)

Bioinformatics

• Gene Symbol: COL12A1