Collagen V Antibody [DyLight 755]

• Reactivity: Hu, Mu
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: DyLight 755

Collagen V Antibody [DyLight 755] Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300-400 of human Collagen V (NP_000084.3).
  
  Sequence:
  LPPLLLLLLWAPPPSRAAQPADLLKVLDFHNLPDGITKTTGFCATRRSSKGPDVAYRVTKDAQLSAPTKQLYPASAFPEDFSILTTVKAKKGSQAFLVSIY
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: COL5A1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

DyLight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

Alternate Names for Collagen V Antibody [DyLight 755]

• alpha 1 type V collagen
• Collagen 5
• collagen alpha-1(V) chain
• collagen, type V, alpha 1
• Collagen-5
• EC 2.7.7.6
• EC 6.1.1

Background

Type V collagen is a minor component of the connective tissue, although it is present in many different types of connective tissue. Patients with defects in the type V collagen (Ehlers-Danlos syndrome) have weakened connective tissue characterized by hyperstrechable joints and fragile, easily bruisable skin.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: COL5A1