COG3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: COG3 Antibody [NBP2-68711] - Staining of human cell line Hep G2 shows localization to the Golgi apparatus.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

COG3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: DGQLFLIKHLLILREQIAPFHTEFTIKEISLDLKKTRDAAFKILNPMTVPRFFRLNSNNALIEFLLEGTPEIREHYLDSKKDVDRHLKSACEQFIQQQT
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
COG3
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100
Control Peptide
COG3 Recombinant Protein Antigen (NBP2-68711PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for COG3 Antibody

  • COG complex subunit 3
  • component of oligomeric golgi complex 3p94
  • SEC34conserved oligomeric Golgi complex subunit 3
  • tethering factor SEC34
  • Vesicle-docking protein SEC34 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31756
Species: Hu
Applications: ICC/IF, WB
NBP1-88071
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-31756
Species: Hu
Applications: ICC/IF, WB
NBP2-57681
Species: Hu
Applications: ICC/IF, WB
NBP1-88204
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-01819
Species: Hu
Applications: Flow, IHC, IHC-P, WB
NBP3-15543
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-05032
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-14292
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1638
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
NBP2-30718
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-93713
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-36949
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
H00003845-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
NBP1-91670
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-45631
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IF, IHC, WB
H00008615-M03
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
H00001523-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NB100-56510
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-20089
Species: Hu
Applications: ICC/IF, KD, WB

Publications for COG3 Antibody (NBP2-68711) (0)

There are no publications for COG3 Antibody (NBP2-68711).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COG3 Antibody (NBP2-68711) (0)

There are no reviews for COG3 Antibody (NBP2-68711). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for COG3 Antibody (NBP2-68711) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional COG3 Products

Bioinformatics Tool for COG3 Antibody (NBP2-68711)

Discover related pathways, diseases and genes to COG3 Antibody (NBP2-68711). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COG3 Antibody (NBP2-68711)

Discover more about diseases related to COG3 Antibody (NBP2-68711).
 

Pathways for COG3 Antibody (NBP2-68711)

View related products by pathway.

PTMs for COG3 Antibody (NBP2-68711)

Learn more about PTMs related to COG3 Antibody (NBP2-68711).

Blogs on COG3

There are no specific blogs for COG3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our COG3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol COG3