COG2 Antibody

Images

 
Western Blot: COG2 Antibody [NBP2-57681] - Western blot analysis in human cell line RT-4, human cell line U-251 MG and human plasma.
Immunocytochemistry/ Immunofluorescence: COG2 Antibody [NBP2-57681] - Staining of human cell line RH-30 shows localization to the Golgi apparatus.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

COG2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VPTTASSYVDSALKPLFQLQSGHKDKLKQAIIQQWLEGTLSESTHKYYETVSDVLNSVKKMEESLKRLKQARKTTPANPVGPSGGMSDDD
Specificity
Specificity of human COG2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
COG2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
COG2 Recombinant Protein Antigen (NBP2-57681PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for COG2 Antibody

  • component of oligomeric golgi complex 2COG complex subunit 2
  • conserved oligomeric Golgi complex protein 2
  • conserved oligomeric Golgi complex subunit 2
  • LDLCbrefeldin A-sensitive, peripheral Golgi protein
  • low density lipoprotein receptor defect C complementing
  • Low density lipoprotein receptor defect C-complementing protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2009
Species: Hu
Applications: WB, IHC
AF7895
Species: Hu
Applications: WB, IHC
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP2-52979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NBP1-81414
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-15937
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-31364
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, Flow-IC
AF5739
Species: Hu, Mu, Rt
Applications: WB
NBP2-58437
Species: Hu
Applications: WB, ICC/IF
NBP2-46005
Species: Hu
Applications: WB, IHC, IF
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57681
Species: Hu
Applications: WB, ICC/IF

Publications for COG2 Antibody (NBP2-57681) (0)

There are no publications for COG2 Antibody (NBP2-57681).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COG2 Antibody (NBP2-57681) (0)

There are no reviews for COG2 Antibody (NBP2-57681). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for COG2 Antibody (NBP2-57681) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for COG2 Antibody (NBP2-57681)

Discover related pathways, diseases and genes to COG2 Antibody (NBP2-57681). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COG2 Antibody (NBP2-57681)

Discover more about diseases related to COG2 Antibody (NBP2-57681).
 

Pathways for COG2 Antibody (NBP2-57681)

View related products by pathway.

PTMs for COG2 Antibody (NBP2-57681)

Learn more about PTMs related to COG2 Antibody (NBP2-57681).
 

Research Areas for COG2 Antibody (NBP2-57681)

Find related products by research area.

Blogs on COG2

There are no specific blogs for COG2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our COG2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol COG2