COG2 Antibody - BSA Free

Western Blot: COG2 Antibody [NBP2-57681] - Analysis in human cell line RT-4, human cell line U-251 MG and human plasma.

Immunocytochemistry/Immunofluorescence: COG2 Antibody [NBP2-57681] - Staining of human cell line RH-30 shows localization to the Golgi apparatus. Antibody staining is shown in green.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

COG2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit COG2 Antibody - BSA Free (NBP2-57681) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VPTTASSYVDSALKPLFQLQSGHKDKLKQAIIQQWLEGTLSESTHKYYETVSDVLNSVKKMEESLKRLKQARKTTPANPVGPSGGMSDDD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: COG2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  COG2 Recombinant Protein Antigen (NBP2-57681PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for COG2 Antibody - BSA Free

• component of oligomeric golgi complex 2COG complex subunit 2
• conserved oligomeric Golgi complex protein 2
• conserved oligomeric Golgi complex subunit 2
• LDLCbrefeldin A-sensitive, peripheral Golgi protein
• low density lipoprotein receptor defect C complementing
• Low density lipoprotein receptor defect C-complementing protein

Background

Multiprotein complexes are key determinants of Golgi apparatus structure and its capacity for intracellular transport and glycoprotein modification. Several complexes have been identified, including the Golgi transport complex (GTC), the LDLC complex, which is involved in glycosylation reactions, and the SEC34 complex, which is involved in vesicular transport. These 3 complexes are identical and have been termed the conserved oligomeric Golgi (COG) complex, which includes COG2 (Ungar et al., 2002 [PubMed 11980916]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: COG2