Coagulation Factor XI Antibody

Images

 
Western Blot: Coagulation Factor XI Antibody [NBP1-74234] - Hela Cell Lysate, Titration: 1 ug/ml, and Gel concentration: 12%

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Coagulation Factor XI Antibody Summary

Immunogen
Synthetic peptides corresponding to the C terminal of F11. Immunizing peptide sequence RHLCGGSIIGNQWILTAAHCFYGVESPKILRVYSGILNQSEIKEDTSFFG.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
F11
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against F11 and was validated on Western blot.
Theoretical MW
70 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Coagulation Factor XI Antibody

  • Coagulation Factor XI
  • EC 3.4.21
  • EC 3.4.21.27
  • FXIPlasma thromboplastin antecedent
  • MGC141891
  • PTA

Background

This gene encodes coagulation factor XI of the blood coagulation cascade. This protein is present in plasma as a zymogen, which is a unique plasma coagulation enzyme because it exists as a homodimer consisting of two identical polypeptide chains linked by disulfide bonds. During activation of the plasma factor XI, an internal peptide bond is cleaved by factor XIIa (or XII) in each of the two chains, resulting in activated factor XIa, a serine protease composed of two heavy and two light chains held together by disulfide bonds. This activated plasma factor XI triggers the middle phase of the intrisic pathway of blood coagulation by activating factor IX. Defects in this factor lead to Rosenthal syndrome, a blood coagulation abnormality.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NB100-91761
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-94203
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15139
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-94203
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
AF1396
Species: Hu
Applications: WB
NBP1-33320
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22617
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-83408
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33581
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NB100-91761
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-32767
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-12547
Species: Hu
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF1310
Species: Hu
Applications: WB, IHC, IP

Publications for Coagulation Factor XI Antibody (NBP1-74234) (0)

There are no publications for Coagulation Factor XI Antibody (NBP1-74234).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Coagulation Factor XI Antibody (NBP1-74234) (0)

There are no reviews for Coagulation Factor XI Antibody (NBP1-74234). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Coagulation Factor XI Antibody (NBP1-74234) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Coagulation Factor XI Products

Bioinformatics Tool for Coagulation Factor XI Antibody (NBP1-74234)

Discover related pathways, diseases and genes to Coagulation Factor XI Antibody (NBP1-74234). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Coagulation Factor XI Antibody (NBP1-74234)

Discover more about diseases related to Coagulation Factor XI Antibody (NBP1-74234).
 

Pathways for Coagulation Factor XI Antibody (NBP1-74234)

View related products by pathway.

PTMs for Coagulation Factor XI Antibody (NBP1-74234)

Learn more about PTMs related to Coagulation Factor XI Antibody (NBP1-74234).
 

Research Areas for Coagulation Factor XI Antibody (NBP1-74234)

Find related products by research area.

Blogs on Coagulation Factor XI

There are no specific blogs for Coagulation Factor XI, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Coagulation Factor XI Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol F11
Entrez
Uniprot