Coagulation Factor III/Tissue Factor Recombinant Protein Antigen

Images

 
There are currently no images for Coagulation Factor III/Tissue Factor Recombinant Protein Antigen (NBP2-55950PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Coagulation Factor III/Tissue Factor Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Coagulation Factor III/Tissue Factor.

Source: E. coli

Amino Acid Sequence: GTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
F3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55950.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Coagulation Factor III/Tissue Factor Recombinant Protein Antigen

  • CD142 antigen
  • CD142
  • coagulation factor III (thromboplastin, tissue factor)
  • Coagulation Factor III
  • F3
  • FLJ17960
  • TF
  • TFA
  • Thromboplastin
  • Tissue Factor

Background

Tissue Factor encodes coagulation factor III which is a cell surface glycoprotein. This factor enables cells to initiate the blood coagulation cascades, and it functions as the high-affinity receptor for the coagulation factor VII. The resulting complex provides a catalytic event that is responsible for initiation of the coagulation protease cascades by specific limited proteolysis. Unlike the other cofactors of these protease cascades, which circulate as nonfunctional precursors, this factor is a potent initiator that is fully functional when expressed on cell surfaces. There are 3 distinct domains of this factor: extracellular, transmembrane, and cytoplasmic. This protein is the only one in the coagulation pathway for which a congenital deficiency has not been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1148
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB
H00008458-M06
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
DTFP10
Species: Hu
Applications: ELISA
NBP1-33320
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
DVE00
Species: Hu
Applications: ELISA
M6000B
Species: Mu
Applications: ELISA
DSE100
Species: Hu
Applications: ELISA
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
AF226
Species: Hu
Applications: WB
AF3894
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, IP, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF2818
Species: Hu
Applications: ICC, WB
137-PS
Species: Hu
Applications: BA
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
AF6796
Species: Hu
Applications: ICC, Simple Western, WB
NBP1-83408
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-55950PEP
Species: Hu
Applications: AC

Publications for Coagulation Factor III/Tissue Factor Recombinant Protein Antigen (NBP2-55950PEP) (0)

There are no publications for Coagulation Factor III/Tissue Factor Recombinant Protein Antigen (NBP2-55950PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Coagulation Factor III/Tissue Factor Recombinant Protein Antigen (NBP2-55950PEP) (0)

There are no reviews for Coagulation Factor III/Tissue Factor Recombinant Protein Antigen (NBP2-55950PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Coagulation Factor III/Tissue Factor Recombinant Protein Antigen (NBP2-55950PEP). (Showing 1 - 1 of 1 FAQ).

  1. Have you tested any of your anti-tissue factor antibodies against pig? I need one for western blot.
    • Unfortunately, none of our Tissue Factor antibodies have yet been tested with pig samples, so we cannot guarantee that any of them will work in pig. Here is a link to Tissue Factor antibodies that have been validated for use in Western blot. If you are interested in testing any of these antibodies against pig samples, you could become eligible for our Innovator's Reward program.

Additional Coagulation Factor III/Tissue Factor Products

Research Areas for Coagulation Factor III/Tissue Factor Recombinant Protein Antigen (NBP2-55950PEP)

Find related products by research area.

Blogs on Coagulation Factor III/Tissue Factor

There are no specific blogs for Coagulation Factor III/Tissue Factor, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Coagulation Factor III/Tissue Factor Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol F3