CNTROB Antibody

Images

 
Immunohistochemistry-Paraffin: CNTROB Antibody [NBP1-82836] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CNTROB Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VHKTKVPLAMASSLFRVPEPPSSHSQGSGPSSGSPERGGDGLTFPRQLMEVSQLLRLYQARGWGALPAEDLLLYLKRLEHSGRTDGRGDNVPRRNTDSRL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CNTROB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CNTROB Protein (NBP1-82836PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CNTROB Antibody

  • centrobin, centrosomal BRCA2 interacting protein
  • centrosomal BRCA2 interacting protein
  • Centrosomal BRCA2-interacting protein
  • LIP8centrobin
  • LYST-interacting protein 8
  • LYST-interacting protein LIP8
  • PP1221

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00055835-M02
Species: Hu
Applications: WB, ELISA, IP
H00004751-M11
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NBP1-88795
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-563
Species: Hu
Applications: WB, IHC-P, IP
NBP1-88559
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-57371
Species: Hu
Applications: ICC/IF
NB100-353
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-174
Species: Hu, Mu, Rt, Ma, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-31310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF4185
Species: Hu
Applications: ICC
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91270
Species: Hu, Mu
Applications: WB (-), ICC/IF, IHC, IHC-P

Publications for CNTROB Antibody (NBP1-82836) (0)

There are no publications for CNTROB Antibody (NBP1-82836).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CNTROB Antibody (NBP1-82836) (0)

There are no reviews for CNTROB Antibody (NBP1-82836). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CNTROB Antibody (NBP1-82836) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CNTROB Products

Bioinformatics Tool for CNTROB Antibody (NBP1-82836)

Discover related pathways, diseases and genes to CNTROB Antibody (NBP1-82836). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CNTROB Antibody (NBP1-82836)

Discover more about diseases related to CNTROB Antibody (NBP1-82836).
 

Pathways for CNTROB Antibody (NBP1-82836)

View related products by pathway.

PTMs for CNTROB Antibody (NBP1-82836)

Learn more about PTMs related to CNTROB Antibody (NBP1-82836).
 

Research Areas for CNTROB Antibody (NBP1-82836)

Find related products by research area.

Blogs on CNTROB

There are no specific blogs for CNTROB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CNTROB Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CNTROB