Home » CNTROB » CNTROB Antibodies » CNTROB Antibody

CNTROB Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: CNTROB Antibody [NBP1-82836] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: CNTROB Antibody [NBP1-82836] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

CNTROB Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VHKTKVPLAMASSLFRVPEPPSSHSQGSGPSSGSPERGGDGLTFPRQLMEVSQLLRLYQARGWGALPAEDLLLYLKRLEHSGRTDGRGDNVPRRNTDSRL
Specificity
Specificity of human CNTROB antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CNTROB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CNTROB Protein (NBP1-82836PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CNTROB Antibody

  • centrobin, centrosomal BRCA2 interacting protein
  • centrosomal BRCA2 interacting protein
  • Centrosomal BRCA2-interacting protein
  • LIP8centrobin
  • LYST-interacting protein 8
  • LYST-interacting protein LIP8
  • PP1221

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

CENPJ Antibody
(1A5)
H00055835-M02
Western Blot: CENPJ Antibody (1A5) [H00055835-M02] - Analysis of CENPJ expression in transfected 293T cell line by CENPJ monoclonal antibody (M02), clone 1A5.Lane 1: CENPJ transfected lysate(43.2 KDa).Lane 2: Non-transfected lysate.
Immunoprecipitation: CENPJ Antibody (1A5) [H00055835-M02] - Analysis of CENPJ transfected lysate using anti-CENPJ monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CENPJ MaxPab rabbit polyclonal antibody.
Sandwich ELISA: CENPJ Antibody (1A5) [H00055835-M02] - Detection limit for recombinant GST tagged CENPJ is 0.1 ng/ml as a capture antibody.
Species: Hu
Applications: WB, ELISA, IP
NEK2 Antibody (3B7)
H00004751-M11
Western Blot: NEK2 Antibody (3B7) [H00004751-M11] - Analysis of NEK2 expression in MCF-7 (Cat # L046V1).
Immunocytochemistry/Immunofluorescence: NEK2 Antibody (3B7) [H00004751-M11] - Analysis of monoclonal antibody to NEK2 on HeLa cell. Antibody concentration 25 ug/ml
Western Blot: NEK2 Antibody (3B7) [H00004751-M11] - Analysis of NEK2 expression in PC-12 (Cat # L012V1).
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
PLK1 Antibody
(13E8)
NB100-74502
Western Blot: PLK1 Antibody (13E8) [NB100-74502] - Proteins were transferred to a PVDF membrane and blocked with 5% Milk/TBST for at least 1 hour. Membranes were probed with PLK1 mouse monoclonal antibody at a dilution of 1:1000 overnight at 4C on a rocking platform. Membranes were washed in TBS-0.1%Tween 20 and probed with a goat anti-mouse-HRP secondary antibody at a dilution of 1:20,000 for at least one hour. Membranes were washed and chemiluminescent detection performed.
Immunocytochemistry/Immunofluorescence: PLK1 Antibody (13E8) [NB100-74502] - PLK1 staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) in WiDr colon carcinoma cells. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing PLK1 at a dilution of 1:20 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
Immunohistochemistry-Paraffin: PLK1 Antibody (13E8) [NB100-74502] - Both normal and cancer biopsies of deparaffinized human Colon tissue.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
CNTLN Antibody
NBP1-88795
Western Blot: CNTLN Antibody [NBP1-88795] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue
Immunocytochemistry/Immunofluorescence: CNTLN Antibody [NBP1-88795] - Staining of human cell line U-251 MG shows positivity in mitochondria and centrosome.
Immunohistochemistry-Paraffin: CNTLN Antibody [NBP1-88795] - Staining of human liver shows moderate cytoplasmic and nuclear positivity in hepatocytes.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAD2L1 Antibody
NB100-563
Immunohistochemistry: MAD2L1 Antibody [NB100-563] - Sample: FFPE section of human lung carcinoma. Antibody: Affinity purified rabbit anti- MAD2 used at a dilution of 1:1,000 (1ug/ml). Detection: DAB
Immunoprecipitation: MAD2L1 Antibody [NB100-563] - Detection of human MAD2 on HeLa whole cell lysate using NB100-563. MAD2 was also immunoprecipitated using NB100-564. Immunoprecipitated MAD2 was blotted using NB100-564.
(1 Review)
(13 Publications)
Species: Hu
Applications: WB, IHC, IHC-P, IP
BNIP2 Antibody
NBP1-88559
Western Blot: BNIP2 Antibody [NBP1-88559] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: BNIP2 Antibody [NBP1-88559] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
Western Blot: BNIP2 Antibody [NBP1-88559] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-64
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
CEP250 Antibody
NBP2-57371
Immunocytochemistry/Immunofluorescence: CEP250 Antibody [NBP2-57371] - Staining of human cell line RH-30 shows localization to centrosome.
Species: Hu
Applications: ICC/IF
BubR1 Antibody
(8G1)
NB100-353
Western Blot: BubR1 Antibody (8G1) [NB100-353] - BUBR1 detected in HeLa cell lysate using NB 100-353.
Immunocytochemistry/Immunofluorescence: BubR1 Antibody (8G1) [NB100-353] - Immunofluorescence of an asynchronous cycling population of human cells (U2OS) with NB100-353. No signal is detected from interphase cells, whereas cells undergoing mitosis accumulate BubR1 at the kinetochores. Image reveals kinetochores at prometaphase. Image courtesy of Luke Hughes-Davies and Rhiannon Jade, Gurdon Institute, Cambridge, UK.
Flow Cytometry: BubR1 Antibody (8G1) [NB100-353] - An intracellular stain was performed on HeLa cells with BubR1 Antibody (8G1)NB100-353C (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Dylight 650.
(6 Publications)
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
AHSA1 Antibody
NBP1-88419
Western Blot: AHSA1 Antibody [NBP1-88419] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/Immunofluorescence: AHSA1 Antibody [NBP1-88419] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: AHSA1 Antibody [NBP1-88419] - Staining of human breast shows strong cytoplasmic positivity in glandular cells.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NuMA Antibody
NB500-174
Western Blot: NuMA Antibody [NB500-174] - Western blot analysis of NuMA expression in Cos7 whole cell lysate.
Immunocytochemistry/Immunofluorescence: NuMA Antibody [NB500-174] - NuMA antibody was tested in HeLa cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
Immunohistochemistry-Paraffin: NuMA Antibody [NB500-174] - IHC analysis of formalin-fixed paraffin-embedded tissue section of human placenta using rabbit polyclonal NuMA antibody (NB500-174) at 5 ug/ml concentration. Strong nuclear with moderate cytoplasmic immuno-reactivity of NuMA was observed in syncytiotrophoblast, cytiotrophoblasts, Hofbauer cells and the endothelial cells of chorionic villi capillaries. [Magnification 10X]
(13 Publications)
Species: Hu, Mu, Rt, Ma, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Crk Antibody
(3G11E8)
NBP2-37568
Western Blot: Crk Antibody (3G11E8) [NBP2-37568] - Western blot analysis using CRK mAb against HEK293 (1) and CRK(AA: 1-204)-hIgGFc transfected HEK293 (2) cell lysate.
Immunocytochemistry/Immunofluorescence: Crk Antibody (3G11E8) [NBP2-37568] - Immunofluorescence analysis of 3T3-L1 cells using CRK mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry: Crk Antibody (3G11E8) [NBP2-37568] - Immunohistochemical analysis of paraffin-embedded lung cancer tissues using CRK mouse mAb with DAB staining.
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
GRAP2 Antibody
(OTI1G2)
NBP2-00764
Western Blot: GRAP2 Antibody (1G2) [NBP2-00764] Analysis of extracts (35ug) from 9 different cell lines by using anti-GRAP2 monoclonal antibody.
Immunohistochemistry-Paraffin: GRAP2 Antibody (1G2) [NBP2-00764] - Staining of paraffin-embedded Human endometrium tissue using anti-GRAP2 mouse monoclonal antibody.
Flow Cytometry: GRAP2 Antibody (1G2) [NBP2-00764] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-GRAP2 antibody, and then analyzed by flow cytometry.
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Annexin A2 Antibody
NBP1-31310
Western Blot: Annexin A2 Antibody [NBP1-31310] - Wild-type (WT) and Annexin II knockout (KO) HeLa cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Annexin II antibody [N1], N-term. The HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: Annexin A2 Antibody [NBP1-31310] - Confocal immunofluorescence analysis (Olympus FV10i) of paraformaldehyde-fixed HeLa, using Annexin A2 Antibody antibody (Green) at 1:500 dilution. Alpha-tubulin filaments were labeled Red.
Immunohistochemistry-Paraffin: Annexin A2 Antibody [NBP1-31310] - Analysis of paraffin-embedded Human pancreas tissue, using ANXA2 antibody at 1:100 dilution.
(4 Publications)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Mxi1 Antibody
NBP1-88626
Western Blot: Mxi1 Antibody [NBP1-88626] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: Mxi1 Antibody [NBP1-88626] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: Mxi1 Antibody [NBP1-88626] - Staining of human cerebral cortex shows moderate to strong nuclear positivity in neurons.
Species: Hu
Applications: WB, IHC, IHC-P
POLDIP2 Antibody
NBP1-68874
Western Blot: POLDIP2 Antibody [NBP1-68874] - (1ug/ml) Analysis of MCF7 lysate (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
Western Blot: POLDIP2 Antibody [NBP1-68874] - (0.5ug/ml) Analysis of Rat VSMC lysate (35ug protein in RIPA buffer). Primary incubation was overnight at 4C. Detected by chemiluminescence. Data provided Dr. B. Lassegue, Emory University, Atlanta, USA
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
p38 alpha Antibody
[Unconjugated]
AF8691
Western blot shows recombinant human p38 beta, p38 gamma, p38δ and Recombinant Human Active p38 alpha (Catalog # 5477-KS) (2 ng/lane). PVDF membrane was probed with 0.5 µg/mL Rabbit Anti-Human/Mouse/Rat p38 alpha Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8691) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and NIH‑3T3 mouse embryonic fibroblast cell line, loaded at 0.2 mg/mL. A specific band was detected for p38 alpha at approximately 43 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat p38 alpha Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8691). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Orexin B, p38 alpha, and Integrin  beta 1 were detected in perfusion fixed frozen sections of mouse brainstem using Human Orexin B Monoclonal Antibody (red; Catalog # MAB734), Rabbit Anti-Human/Mouse/Rat p38 alpha Antigen Affinity-purified Polyclonal Antibody (green; Catalog # AF8691), and Mouse Integrin  beta 1 Antigen Affinity-purified Polyclonal Antibody (blue; Catalog # AF2405). Tissue was incubated with primary antibodies overnight at 4 °C. Tissue was stained using NorthernLights™ 493-conjugated Anti-Rabbit IgG Secondary Antibody (green; Catalog # NL006), NorthernLights 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007), and NorthernLights 637-conjugated Anti-Goat IgG Secondary Antibody (blue; Catalog # NL002). The image of Integrin beta 1 is pseudo-colored for presentation. View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, KO
AIMP2 Antibody
NBP1-81575
Western Blot: AIMP2 Antibody [NBP1-81575] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/Immunofluorescence: AIMP2 Antibody [NBP1-81575] - Immunofluorescent staining of human cell line A549 shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: AIMP2 Antibody [NBP1-81575] - Staining of human testis shows weak to moderate cytoplasmic positivity in cells in seminiferous ducts.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
ZNF521 Antibody
NBP1-91270
Immunocytochemistry/Immunofluorescence: ZNF521 Antibody [NBP1-91270] - Zfp521 antibody was tested in U2OS cells with FITC (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
Immunohistochemistry: ZNF521 Antibody [NBP1-91270] - IHC analysis of ZFP521 in mouse epidermis using DAB with hematoxylin counterstain.
Species: Hu, Mu
Applications: WB (-), ICC/IF, IHC, IHC-P

Publications for CNTROB Antibody (NBP1-82836) (0)

There are no publications for CNTROB Antibody (NBP1-82836).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CNTROB Antibody (NBP1-82836) (0)

There are no reviews for CNTROB Antibody (NBP1-82836). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CNTROB Antibody (NBP1-82836) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for CNTROB Antibody (NBP1-82836)

Discover related pathways, diseases and genes to CNTROB Antibody (NBP1-82836). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CNTROB Antibody (NBP1-82836)

Discover more about diseases related to CNTROB Antibody (NBP1-82836).
 

Pathways for CNTROB Antibody (NBP1-82836)

View related products by pathway.

PTMs for CNTROB Antibody (NBP1-82836)

Learn more about PTMs related to CNTROB Antibody (NBP1-82836).
 

Research Areas for CNTROB Antibody (NBP1-82836)

Find related products by research area.

Blogs on CNTROB

There are no specific blogs for CNTROB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CNTROB Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol CNTROB