CNOT8 Antibody (1F11) - Azide and BSA Free

Immunocytochemistry/Immunofluorescence: CNOT8 Antibody (1F11) [H00009337-M01] - CNOT8 antibody was used (1:50) for labeling and microscopy analysis of the distribution of CNOT8 proteins in MDA-MB-231 cells. Image from verified customer review.

Sandwich ELISA: CNOT8 Antibody (1F11) [H00009337-M01] - Detection limit for recombinant GST tagged CNOT8 is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 1F11
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

CNOT8 Antibody (1F11) - Azide and BSA Free Summary

• Immunogen: CNOT8 (NP_004770.4, 201 a.a. ~ 292 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SCKNLKGGLQEVADQLDLQRIGRQHQAGSDSLLTGMAFFRMKELFFEDSIDDAKYCGRLYGLGTGVAQKQNEDVDSAQEKMSILAIINNMQQ
• Specificity: Reacts with CCR4-NOT transcription complex, subunit 8.
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: CNOT8
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Sandwich ELISA
  • Western Blot
• Application Notes: This antibody is reactive against recombinant protein in western blot and ELISA. CNOT8 Antibody (1F11) validated for Immunocytochemistry/Immunofluorescence from a verified customer review.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CNOT8 Antibody (1F11) - Azide and BSA Free

• CAF1
• CAF2
• CALIFCAF1-like protein
• CALIFp
• CCR4-NOT transcription complex subunit 8
• CCR4-NOT transcription complex, subunit 8
• hCAF1
• PGK promoter directed over production
• POP2CCR4-associated factor 8

Background

Ubiquitous transcription factor required for a diverse set of processes. The CCR4-NOT complex functions as general transcription regulation complex

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Review for CNOT8 Antibody (H00009337-M01) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Verified Customer IF Human 10/20/2022

Summary

• Application: Immunofluorescence
• Sample Tested: MDA-MB-231 cell
• Species: Human
• Lot: I5071-1F11

Bioinformatics

• Gene Symbol: CNOT8
• Entrez:
  • 9337(Human)
• Uniprot:
  • NP_004770(Human)