CNOT3 Antibody

Images

 
Western Blot: CNOT3 Antibody [NBP1-82971] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: CNOT3 Antibody [NBP1-82971] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemistry-Paraffin: CNOT3 Antibody [NBP1-82971] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CNOT3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TPAPYAQAVAPPAPSGPSTTQPRPPSVQPSGGGGGGSGGGGSSSSSNSSAGGGAGKQNGATSYSSVVADSPAEVALSSSGGNNASSQALGPPSGPHNPPPSTSKEPSA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CNOT3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CNOT3 Protein (NBP1-82971PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CNOT3 Antibody

  • CCR4-NOT transcription complex, subunit 3
  • KIAA0691CCR4-associated factor 3
  • LENG2yeast) homolog
  • Leukocyte receptor cluster member 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15930
Species: Hu
Applications: WB, ICC/IF
NBP2-31892
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46323
Species: Hu
Applications: WB, IHC
NBP1-86564
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB500-207
Species: Hu
Applications: WB, ICC/IF, IP
H00029883-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB500-212
Species: Hu
Applications: WB, ICC/IF, IP
NBP2-37856
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
MAB1567
Species: Hu
Applications: Flow, CyTOF-reported
NBP2-24527
Species: Hu, Mu, Rt, Bv, Ch, Xp
Applications: WB, IHC-P
NBP1-87256
Species: Hu
Applications: IHC, IHC-P
H00055832-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-78048
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-84186
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81215
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-07100
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00054766-M07
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-47801
Species: Hu, Mu, Rt, Ca, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF2009
Species: Hu
Applications: WB, IHC

Publications for CNOT3 Antibody (NBP1-82971) (0)

There are no publications for CNOT3 Antibody (NBP1-82971).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CNOT3 Antibody (NBP1-82971) (0)

There are no reviews for CNOT3 Antibody (NBP1-82971). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CNOT3 Antibody (NBP1-82971) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CNOT3 Products

Bioinformatics Tool for CNOT3 Antibody (NBP1-82971)

Discover related pathways, diseases and genes to CNOT3 Antibody (NBP1-82971). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CNOT3 Antibody (NBP1-82971)

Discover more about diseases related to CNOT3 Antibody (NBP1-82971).
 

Pathways for CNOT3 Antibody (NBP1-82971)

View related products by pathway.

Blogs on CNOT3

There are no specific blogs for CNOT3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CNOT3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CNOT3