CNO Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: CNO Antibody [NBP1-91798] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.

Immunohistochemistry-Paraffin: CNO Antibody [NBP1-91798] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CNO Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: YAACLLPGAGARPEVEALDASLEDLLTRVDEFVGMLDMLRGDSSHVVSEGVPRIHAKAAEMRRIYSR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BLOC1S4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CNO Protein (NBP1-91798PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (87%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CNO Antibody - BSA Free

• BCAS4L
• cappuccino homolog (mouse)
• FLJ11230
• protein cappuccino homolog

Background

CNO encodes a protein that may play a role in organelle biogenesis associated with melanosomes, platelet dense granules, and lysosomes. A similar protein in mouse is a component of a protein complex termed biogenesis of lysosome-related organelles complex 1 (BLOC-1), and is a model for Hermansky-Pudlak syndrome. The encoded protein may play a role in intracellular vesicular trafficking.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BLOC1S4